BYKdb

Annotate results for A0A0Q6DVM4

A0A0Q6DVM4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6DVM4
DOMAINcd267/459TSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDVLAGRAQ
IEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVAD
AAVIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQ
YGGYYGYGIGRTE
SITEWalker A274/276GKS
SITEWalker A'294/301ILVDADLR
SITEWalker B374/380VIVDSPP
SITEY Cluster442/453YYGMQYGGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRILRAYWKAIVVMTVLGGLAGLGWSATQARVYSADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVADTA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQQLGLSDSPEALVERIRVSNPVDTVNVRVDATGATPESARDLAEAWIRAMTTQVDELESGGSGQGAVRLVAGDSARLPT


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPSSPNVRLDVMIGALLGLVAGVVFALVRRTFDRRLRSASDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKEAMRELRTNLQYVDVDRPARIMVVTSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
                          TSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
                                 GKS                 ILVDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
                                                     VIVDSPP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTEKSTWWRRVLRKSSTEPGAAEE
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTE                     
                                         YYGMQYGGYYGY                           
       490       500       510       520       530       540
....:....|....:....|....:....|....:....|....:....|....:....|
HGKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPRRRRTTP


© 1998-2019