BYKdb

Annotate results for A0A0Q6G4R0

A0A0Q6G4R0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q6G4R0
DOMAINtad1/111MSNPNADNSRIESEVAILKSDSVLLNVVRENNLVTDSEFGIKVSLKDKILSWLRIPLPPA
PTGDEALARVLDAFKSAVRVNREGLTYVINVGVVSTDPVKAATLANSLGEI
DOMAINcd463/652SSALPNEGKSTMALSLARAYALTGKRTLLIDCDLRKPSVNKQLNLEPNHDFIDYLRQDRS
SATLTSLIMRDPLSNLTVLLGGRRSDIATDELVMSEKMGRILSSARKHFDYVILDTPPVE
PVVDGLYLARHADMIVFVIKWASTPQSSAKRAVAALKENKNPDAGIVTLLNQQDRAKMSG
NYSYSGYYTE
SITEWalker A470/472GKS
SITEWalker A'490/497LLIDCDLR
SITEWalker B574/580VILDTPP
SITEY Cluster644/650YSYSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNPNADNSRIESEVAILKSDSVLLNVVRENNLVTDSEFGIKVSLKDKILSWLRIPLPPAPTGDEALARVLDAFKSAVRV
MSNPNADNSRIESEVAILKSDSVLLNVVRENNLVTDSEFGIKVSLKDKILSWLRIPLPPAPTGDEALARVLDAFKSAVRV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NREGLTYVINVGVVSTDPVKAATLANSLGEIYISEQLNAKVASTLTNRDTIQKQVEAANAAMVASENDFDSYISENIERL
NREGLTYVINVGVVSTDPVKAATLANSLGEI                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKQSNAVGLTDLKAELSKINDDRTSELRRITTLQASLQSQDFSSLVNELGSQALAELQSQREDLAKRIASTTSDSPESIN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRAELAKVDNSLSSAATQEVDNLQKAVENYQKQADDVRKKIRSTVLDSNLPMEVLAQMFSMQKSSEIARQQYQTLLSRKT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELESQASLQLPDSRVVSAALVPTSPSFPNNKVILGMSLLFAIGFGTGLAILREYFIGGFVSENQIEAVLKVPLSAIAPRQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATGDEHHKLASPTSSLADLMVTAPLSLFSESVRRLRLTLDQQERKHTGVKSQDADEGAIIMVSSALPNEGKSTMALSLAR
                                                              SSALPNEGKSTMALSLAR
                                                                     GKS        
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYALTGKRTLLIDCDLRKPSVNKQLNLEPNHDFIDYLRQDRSSATLTSLIMRDPLSNLTVLLGGRRSDIATDELVMSEKM
AYALTGKRTLLIDCDLRKPSVNKQLNLEPNHDFIDYLRQDRSSATLTSLIMRDPLSNLTVLLGGRRSDIATDELVMSEKM
         LLIDCDLR                                                               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRILSSARKHFDYVILDTPPVEPVVDGLYLARHADMIVFVIKWASTPQSSAKRAVAALKENKNPDAGIVTLLNQQDRAKM
GRILSSARKHFDYVILDTPPVEPVVDGLYLARHADMIVFVIKWASTPQSSAKRAVAALKENKNPDAGIVTLLNQQDRAKM
             VILDTPP                                                            
       650  
....:....|..
SGNYSYSGYYTE
SGNYSYSGYYTE
   YSYSGYY  
© 1998-2019