BYKdb

Annotate results for A0A0Q6HRT0

A0A0Q6HRT0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6HRT0
DOMAINcd50/227TSAEPNDGKSTTAANLAIVLAQEEKKVLLVDADLRKPSIHYAFNLSNIHGLTSVLTKKMD
LRKTILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFDTPPVLLVTD
SQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
SITE-187/-189GKT
SITEWalker A'77/84LLVDADLR
SITEWalker B157/163IIFDTPP
SITEY Cluster223/225YYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGFLRSKDEKQVNLIAQTNPKSPITERYRIIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
                                                 TSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
                                                        GKS                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
ADLR                                                                        IIFD
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
TPP                                                           YYY  
© 1998-2019