BYKdb

Annotate results for A0A0Q6I7X8

A0A0Q6I7X8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6I7X8
DOMAINcd44/224TSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKPTAHYTFRLENHTGLTNVLTRQSS
LGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILAVAD
AQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGS
N
SITEWalker A51/53GKS
SITEWalker A'71/78LLIDGDLR
SITEWalker B151/157VIFDTPP
SITEY Cluster217/221YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKP
                                           TSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKP
                                                  GKS                 LLIDGDLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAHYTFRLENHTGLTNVLTRQSSLGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
TAHYTFRLENHTGLTNVLTRQSSLGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
                                                                      VIFDTPP   
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
                                                        YYYYY   
© 1998-2019