BYKdb

Annotate results for A0A0Q6N5L1

A0A0Q6N5L1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q6N5L1
DOMAINtad9/266DEINIAEWIDILIDRKWLVAIVTALVLVLGVAYALMSTPIYQSNLLVQVEDAAPDAKGFL
GEASNLFDVKTPASGEIQVIRSRMVLGAAVDKTHAYIDAKPRYLPVLGTWLARRANGLSD
PGFFGIGGYVNGSESIGVARFDVPAQLEDDEPFMITAQGEGKYTLTHEALTRPLTGTVGQ
PLHQVLEDGAIDLLIDNLEGKPGAQFVVSRASQLRTIEDLQKRLQLAEQGKQSNVINVAL
EDSDREWLSRILNAIGEQ
DOMAINcd543/732TGATPDIGKSFVSGNFAAIMAHAGKRVLLIDADMRKGHLNKQFGLPRESGLSELLAGELS
AQQAIRSQVLPNLDILTTGKLPSNPADMLMSESFVRLLDMMSAQYELVVIDTPPVLVAAD
TAAVAPYMGAVLLVARADQTQLGELNESAKRLSHGGKAVSGVIFNGIDLTRRHYGSQGYR
YGGYRYTKYK
SITEWalker A550/552GKS
SITEWalker A'570/577LLIDADMR
SITEWalker B650/656VVIDTPP
SITEY Cluster716/733YGSQGYRYGGYRYTKYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTAAADDDEINIAEWIDILIDRKWLVAIVTALVLVLGVAYALMSTPIYQSNLLVQVEDAAPDAKGFLGEASNLFDVKTP
        DEINIAEWIDILIDRKWLVAIVTALVLVLGVAYALMSTPIYQSNLLVQVEDAAPDAKGFLGEASNLFDVKTP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGEIQVIRSRMVLGAAVDKTHAYIDAKPRYLPVLGTWLARRANGLSDPGFFGIGGYVNGSESIGVARFDVPAQLEDDEP
ASGEIQVIRSRMVLGAAVDKTHAYIDAKPRYLPVLGTWLARRANGLSDPGFFGIGGYVNGSESIGVARFDVPAQLEDDEP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FMITAQGEGKYTLTHEALTRPLTGTVGQPLHQVLEDGAIDLLIDNLEGKPGAQFVVSRASQLRTIEDLQKRLQLAEQGKQ
FMITAQGEGKYTLTHEALTRPLTGTVGQPLHQVLEDGAIDLLIDNLEGKPGAQFVVSRASQLRTIEDLQKRLQLAEQGKQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNVINVALEDSDREWLSRILNAIGEQYVQQNVERKAAEAQKTLAFLDEQLPEFKRQLEASEDAYTHFRNKNGTVAFDEEA
SNVINVALEDSDREWLSRILNAIGEQ                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGVLAQTIELQTRLLESQQKRRELAAHFTDANLRVRTIDGQIAAIEKEIGGLNARVSRMPTLQQDALRLERDVRVNSGLY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSLQNNALQLRLVKEGKTGNVRLLDKAVKPKKPVKPQKLLIVALSLVLGLLAGTALALMRSWFFRGIQDPQEIEAHTGLS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYSVVPFTPEQVALDQSIAAGVKGIQLLAVTHPDSPSIEALRSLRIALQFATLEAGNNRVLITGATPDIGKSFVSGNFAA
                                                              TGATPDIGKSFVSGNFAA
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IMAHAGKRVLLIDADMRKGHLNKQFGLPRESGLSELLAGELSAQQAIRSQVLPNLDILTTGKLPSNPADMLMSESFVRLL
IMAHAGKRVLLIDADMRKGHLNKQFGLPRESGLSELLAGELSAQQAIRSQVLPNLDILTTGKLPSNPADMLMSESFVRLL
         LLIDADMR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMMSAQYELVVIDTPPVLVAADTAAVAPYMGAVLLVARADQTQLGELNESAKRLSHGGKAVSGVIFNGIDLTRRHYGSQG
DMMSAQYELVVIDTPPVLVAADTAAVAPYMGAVLLVARADQTQLGELNESAKRLSHGGKAVSGVIFNGIDLTRRHYGSQG
         VVIDTPP                                                           YGSQG
       730     
....:....|....:
YRYGGYRYTKYKYNE
YRYGGYRYTKYK   
YRYGGYRYTKYKY  

© 1998-2019