BYKdb

Annotate results for A0A0Q6QV61

A0A0Q6QV61 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6QV61
DOMAINcd65/241TSPTPACGKTFTAVNLAFSLANQPDCRTLLLDLDLRRPQVGKTLGIKNAGSMESFLRREI
ECDDVFMRYGDNLAIAPNRQPAQYSAELLQSTTTAEALLEMRQRMSPDIILFDLPPMLST
DDVLAFLPNVDCVVLVAAAEHSTLSEVDVCEQSLAEKTNVLGVVLNRCQYSAEKYGY
SITE-105/-107GKT
SITEWalker A'93/100LLLDLDLR
SITEWalker B174/180ILFDLPP
SITEY Cluster234/241YSAEKYGY
SITEWalker A72/74GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSREEENQITWTELPPLKIDPDAIARNRIVTANRSDIAHVAFDMMRTKLLQSLRQNNWKSVAITSPTPACGKTFTAVNL
                                                                TSPTPACGKTFTAVNL
                                                                       GKT      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFSLANQPDCRTLLLDLDLRRPQVGKTLGIKNAGSMESFLRREIECDDVFMRYGDNLAIAPNRQPAQYSAELLQSTTTAE
AFSLANQPDCRTLLLDLDLRRPQVGKTLGIKNAGSMESFLRREIECDDVFMRYGDNLAIAPNRQPAQYSAELLQSTTTAE
            LLLDLDLR                                                            
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLEMRQRMSPDIILFDLPPMLSTDDVLAFLPNVDCVVLVAAAEHSTLSEVDVCEQSLAEKTNVLGVVLNRCQYSAEKYG
ALLEMRQRMSPDIILFDLPPMLSTDDVLAFLPNVDCVVLVAAAEHSTLSEVDVCEQSLAEKTNVLGVVLNRCQYSAEKYG
             ILFDLPP                                                     YSAEKYG
 
.
Y
Y
Y
© 1998-2019