BYKdb

Annotate results for A0A0Q6SWX9

A0A0Q6SWX9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q6SWX9
DOMAINtad21/203TFIDLNRLTAIAFRRSRVVALCVVLCFMLGVAYLVFATPVYTSQTQILLDENLSKYAEEA
PSPQSAQQADTQLSSAVEILKSGELALRVTDAENLGENETVLNPPRSLMSTVKAAVKSLT
GMFSSGPEISEAAARNGKRETAAAYIQQGLTVERVARSSVVAVSYKSTDPKLAATITRAY
ANA
DOMAINcd578/769VSALPGEGKSTIAANFAGLLAASGKRTLLIDADIRNPAISKMISPAPKTGLVDAVLGEEE
WTSALRVDPQTRLAILPIAPRDHLYHTNELLASQGMETLIANARKSFDYVIVDLAPLAPV
IDAKAFSPFADGFLMVIEWGKTPARLVRDVLHSDPQFNAKILGVILNKTDMDELGKYSDF
GAAEKYRKSYES
SITE-717/-719GKT
SITEWalker A'605/612LLIDADIR
SITEWalker B687/693VIVDLAP
SITEY Cluster763/771YRKSYESYY
SITEWalker A585/587GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQRPLPLNTVPSLKGDESDTFIDLNRLTAIAFRRSRVVALCVVLCFMLGVAYLVFATPVYTSQTQILLDENLSKYAEEA
                    TFIDLNRLTAIAFRRSRVVALCVVLCFMLGVAYLVFATPVYTSQTQILLDENLSKYAEEA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSPQSAQQADTQLSSAVEILKSGELALRVTDAENLGENETVLNPPRSLMSTVKAAVKSLTGMFSSGPEISEAAARNGKRE
PSPQSAQQADTQLSSAVEILKSGELALRVTDAENLGENETVLNPPRSLMSTVKAAVKSLTGMFSSGPEISEAAARNGKRE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAAAYIQQGLTVERVARSSVVAVSYKSTDPKLAATITRAYANAYLTDQLNANFDATERASVWLQERLTDLGQRAQAASLE
TAAAYIQQGLTVERVARSSVVAVSYKSTDPKLAATITRAYANA                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEKFKADNGLTSTRGELMSEQQLSDLNSQLIVAQADSASASARYNQFKSIIDQGAENAVNNATISSNQTDNSVIQDLRTR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLAISKREQAVTQNFSADHPQAVSLRAEKTELAGQIFRELQQITSSYRNEFEVAQSREASLRKSIKGVVGNNSEANRSLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLRGLEQRATALKTLYESYLGRFEEAAQQRSFPIAKARIISDAGVPVSPSSPKRTMVLALSIVLGFMLGAVIAGLQEFRE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFFRLEEDIRSVLGHKSLGYLPLIGKKTVSMWSKTRERLSKSEQDKADKPADADVPLNRMTRIAVDAPRSAFAETLRNAK


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASDVILQGRPNRVIGVVSALPGEGKSTIAANFAGLLAASGKRTLLIDADIRNPAISKMISPAPKTGLVDAVLGEEEWTS
                 VSALPGEGKSTIAANFAGLLAASGKRTLLIDADIRNPAISKMISPAPKTGLVDAVLGEEEWTS
                        GKS                 LLIDADIR                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALRVDPQTRLAILPIAPRDHLYHTNELLASQGMETLIANARKSFDYVIVDLAPLAPVIDAKAFSPFADGFLMVIEWGKTP
ALRVDPQTRLAILPIAPRDHLYHTNELLASQGMETLIANARKSFDYVIVDLAPLAPVIDAKAFSPFADGFLMVIEWGKTP
                                              VIVDLAP                           
       730       740       750       760       770       780
....:....|....:....|....:....|....:....|....:....|....:....|
ARLVRDVLHSDPQFNAKILGVILNKTDMDELGKYSDFGAAEKYRKSYESYYIEQPFKAAR
ARLVRDVLHSDPQFNAKILGVILNKTDMDELGKYSDFGAAEKYRKSYES           
                                          YRKSYESYY         

© 1998-2019