BYKdb

Annotate results for A0A0Q6TS97

A0A0Q6TS97 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6TS97
DOMAINcd387/574ISTRPREGKSTTTVALAQSLARARRKVVLVDADLRSPSVHSAFGLKNGLGVSNFLSGAED
LDSVLHATEHEGLWVMTAGPPPPNAGDLLMGDRLALLVKRLKERFDHVIVDSPPVIGLAD
APLVAAAVDGVVYAVEARSVPAGTVRAALSRLRASQAHILGAVLTKFEAKKAGYGFDYGY
GFDYDYGR
SITEWalker A394/396GKS
SITEWalker A'414/421VLVDADLR
SITEWalker B494/500VIVDSPP
SITEY Cluster560/572YGFDYGYGFDYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGKILLQHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKFLEGRIEQLREKLEMSERQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVAYAVQQGIINLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNEIKRPDASSIALGNDAIASMRQ


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRADAAAEYAKLMVQFRPDYPQAKALASQIQALDAAIGQEEGRVRVSLQQAYDSSQTRERALTARVEGLKDGLADLRRRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQYNIYQRDADTNRELYNALLQRYKEIGVAGGAENNNVAIVDPARLPDRPASPKLLVNLVLAMMAGGLAAALVAAGLEQI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEGIVDPADLEEKLGLPLLGVAPKVQVEDPLMALRDPRSKLVEAYLSVHANLELSTAKGAPRSLAVISTRPREGKSTTTV
                                                                  ISTRPREGKSTTTV
                                                                         GKS    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALAQSLARARRKVVLVDADLRSPSVHSAFGLKNGLGVSNFLSGAEDLDSVLHATEHEGLWVMTAGPPPPNAGDLLMGDRL
ALAQSLARARRKVVLVDADLRSPSVHSAFGLKNGLGVSNFLSGAEDLDSVLHATEHEGLWVMTAGPPPPNAGDLLMGDRL
             VLVDADLR                                                           
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLVKRLKERFDHVIVDSPPVIGLADAPLVAAAVDGVVYAVEARSVPAGTVRAALSRLRASQAHILGAVLTKFEAKKAGY
ALLVKRLKERFDHVIVDSPPVIGLADAPLVAAAVDGVVYAVEARSVPAGTVRAALSRLRASQAHILGAVLTKFEAKKAGY
             VIVDSPP                                                           Y
       570    
....:....|....
GFDYGYGFDYDYGR
GFDYGYGFDYDYGR
GFDYGYGFDYDY  
© 1998-2019