BYKdb

Annotate results for A0A0Q6VA36

A0A0Q6VA36 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6VA36
DOMAINcd86/262TSPTPGCGKTFVAANLAFSLANQKDCRTLLLDLDLRRPQVGKTLGIKNAASMESFLKGEI
EVGDTFLRHEENLAIAANRKPAQFSAELLQSTASTDALFEMKQRMMPDIILFDLPPMLST
DDVLAFLPNVDCVILVAAAEHSTLAEVDVCEHSLAAKANVLGVVLNKCKFTPEKYGY
SITE-126/-128GKT
SITEWalker A'114/121LLLDLDLR
SITEWalker B195/201ILFDLPP
SITEY Cluster260/262YGY
SITEWalker A93/95GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQTVVSAQNPAAHRDGDRMPVSRSQELSQIAWDALSPLVIDHDAIARNRIVTANRSDTAHVAFDMLRTKLLQELRQNNW


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSVAITSPTPGCGKTFVAANLAFSLANQKDCRTLLLDLDLRRPQVGKTLGIKNAASMESFLKGEIEVGDTFLRHEENLAI
     TSPTPGCGKTFVAANLAFSLANQKDCRTLLLDLDLRRPQVGKTLGIKNAASMESFLKGEIEVGDTFLRHEENLAI
            GKT                  LLLDLDLR                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AANRKPAQFSAELLQSTASTDALFEMKQRMMPDIILFDLPPMLSTDDVLAFLPNVDCVILVAAAEHSTLAEVDVCEHSLA
AANRKPAQFSAELLQSTASTDALFEMKQRMMPDIILFDLPPMLSTDDVLAFLPNVDCVILVAAAEHSTLAEVDVCEHSLA
                                  ILFDLPP                                       
       250       260  
....:....|....:....|..
AKANVLGVVLNKCKFTPEKYGY
AKANVLGVVLNKCKFTPEKYGY
                   YGY
© 1998-2019