BYKdb

Annotate results for A0A0Q6VV12

A0A0Q6VV12 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q6VV12
DOMAINcd268/456TSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQALAGDVD
VRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDA
GLLSAFCDGALLVQAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGY
SGYGGYGGY
SITEWalker A275/277GKS
SITEWalker A'295/302LLIDADLR
SITEWalker B374/380VILDAPP
SITEY Cluster443/456YGGGYSGYGGYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYAFLVSSMP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAEKVVDDLGLDVPPSEIAGRFSATVNADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNPRRDPLTRVVP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQPAELPQAPFTPDYAKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGIIPKEDALGRTHRGVRGDLG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
                           TSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
                                  GKS                 LLIDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
                                                     VILDAPP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGYRAEEATREAYSTAGKGRRRKLVRS
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGY                        
                                          YGGGYSGYGGYGGY                        
     
....:
SSDKA


© 1998-2019