BYKdb

Annotate results for A0A0Q7C9B6

A0A0Q7C9B6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7C9B6
DOMAINtad27/285RESRFHEYLDILIDSRWLIASIAALTLLVGVGYALFGPRMYEANILIQVEDPDRSGGNFP
GDANGGGGISVKTPTAGETEILRSRMVLGQAMENTRLFISAKPHYIPVVGEFMARHSSQL
STPGVFGHGNFVSGTERIAVAQMDVPSAFEGKKFTLIAGSDGNYTLTNPDLETPLQGTAG
VPLEAAVPGGTLHLLVGSFEAQPGGAFELVRYSKQLTLLGLQKDLRVVEKGKQSGVMDVS
LQAANRGQLADVLNEISRL
DOMAINcd562/751SSATAGAGKTFVSSNFATLLAASGQRVLLIDADLRRGKLSQEFGLQSKEGLADILAGGVP
LDDAIHHHVLPHLDVMAAGTLHPDPAGMMTSDAFAHTLSTLSARYDVVVVDGPPALLASE
TAAMAPSMGTVLLVARAGNSELGELVESAKRLAHVGAAFHGAVFNAVDTSQRHYRSYSYG
YYAYAPTRRE
SITEWalker A569/571GKT
SITEWalker A'589/596LLIDADLR
SITEWalker B669/675VVVDGPP
SITEY Cluster735/745YRSYSYGYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNARWQPSLPAPAAAPMTVLETTAWPRESRFHEYLDILIDSRWLIASIAALTLLVGVGYALFGPRMYEANILIQVEDPDR
                          RESRFHEYLDILIDSRWLIASIAALTLLVGVGYALFGPRMYEANILIQVEDPDR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGGNFPGDANGGGGISVKTPTAGETEILRSRMVLGQAMENTRLFISAKPHYIPVVGEFMARHSSQLSTPGVFGHGNFVSG
SGGNFPGDANGGGGISVKTPTAGETEILRSRMVLGQAMENTRLFISAKPHYIPVVGEFMARHSSQLSTPGVFGHGNFVSG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TERIAVAQMDVPSAFEGKKFTLIAGSDGNYTLTNPDLETPLQGTAGVPLEAAVPGGTLHLLVGSFEAQPGGAFELVRYSK
TERIAVAQMDVPSAFEGKKFTLIAGSDGNYTLTNPDLETPLQGTAGVPLEAAVPGGTLHLLVGSFEAQPGGAFELVRYSK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLTLLGLQKDLRVVEKGKQSGVMDVSLQAANRGQLADVLNEISRLYVRQNIDQKTVQAERALAFLGTELPKFKQQLEQSE
QLTLLGLQKDLRVVEKGKQSGVMDVSLQAANRGQLADVLNEISRL                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAYNQYRNQNGTISLDDEARNALSQNVDLQAKLLDAKQKRLDLASRFTAAHPDLKTLDAQIASLKKELGSVDGRIRRMPM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQQNSLRMQRDIKVNTDLYATLLNSSLQMRLAKEGKVANVRVLDLALQAEKPVRPKPLIVVALALAGGLFLGGAAALARK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLRRSIGNPDDIEAVTGLQVYTSIPMSPQQRVLDRAVRKGKPGIKVLAALHVEDPALEGLRRLRTALKFVMMGAPNNRVL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISSATAGAGKTFVSSNFATLLAASGQRVLLIDADLRRGKLSQEFGLQSKEGLADILAGGVPLDDAIHHHVLPHLDVMAAG
 SSATAGAGKTFVSSNFATLLAASGQRVLLIDADLRRGKLSQEFGLQSKEGLADILAGGVPLDDAIHHHVLPHLDVMAAG
        GKT                 LLIDADLR                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLHPDPAGMMTSDAFAHTLSTLSARYDVVVVDGPPALLASETAAMAPSMGTVLLVARAGNSELGELVESAKRLAHVGAAF
TLHPDPAGMMTSDAFAHTLSTLSARYDVVVVDGPPALLASETAAMAPSMGTVLLVARAGNSELGELVESAKRLAHVGAAF
                            VVVDGPP                                             
       730       740       750       760       770    
....:....|....:....|....:....|....:....|....:....|....
HGAVFNAVDTSQRHYRSYSYGYYAYAPTRREPTYALDTADTVMPKRIQPEHAES
HGAVFNAVDTSQRHYRSYSYGYYAYAPTRRE                       
              YRSYSYGYYAY                             

© 1998-2019