BYKdb

Annotate results for A0A0Q7ECL8

A0A0Q7ECL8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7ECL8
DOMAINtad44/213PAFDLASYWRMAIKHRILIIGCFIGALVIGAAITMLMTPIYTAQATLQIDREAARVFTSE
DVTPRESMSQGEEFYQTQYGLLRSRSLAERVVEGLGLASSDRALEALGVEAPARTGTAAA
QAERRRNLAIATLQANLSVTPVRGSRLVAIGYDNPDPVVAARVANGFAEN
DOMAINcd558/746SSARPAEGKSTTAYAVALNLARVGKRVLLIDGDLRNPSMHRVVGVDNDRGMSNLLSGSSD
LNTVVQRTRQDNLFFIPCGPLPPNPAELWGSDRFRQFLAEARNNFDHVVVDGPPVLGFAD
SPLLSATVGGVLFVLESRGTRRGQARGALRRLRVGRARLLGAVLTKFNAKTTTYGGYDYA
YDYNYGGDH
SITEWalker A565/567GKS
SITEWalker A'585/592LLIDGDLR
SITEWalker B665/671VVVDGPP
SITEY Cluster731/742YGGYDYAYDYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMLGDPSADDRNLRTGRAPAPFGDSVYDDMHNAVWTGEEPHEQPAFDLASYWRMAIKHRILIIGCFIGALVIGAAITMLM
                                           PAFDLASYWRMAIKHRILIIGCFIGALVIGAAITMLM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPIYTAQATLQIDREAARVFTSEDVTPRESMSQGEEFYQTQYGLLRSRSLAERVVEGLGLASSDRALEALGVEAPARTGT
TPIYTAQATLQIDREAARVFTSEDVTPRESMSQGEEFYQTQYGLLRSRSLAERVVEGLGLASSDRALEALGVEAPARTGT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAQAERRRNLAIATLQANLSVTPVRGSRLVAIGYDNPDPVVAARVANGFAENFIQANLDRKYESSSYAREFLEERIAQT
AAAQAERRRNLAIATLQANLSVTPVRGSRLVAIGYDNPDPVVAARVANGFAEN                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGRLEEAERQLVAYAANQQIINVGEPSEGGQGAGEAQSLASNNLVALNSSLASARAARVAAEEKWRSARSSQIMTLPEVL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNPSIQRLTEQRAALEAEYQQKASLYQADYPEMQRLRGQISEVDGQIQALAANIRASIQSEYVIAANQERSLQGQVNGLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDVLDLRDRSIQYNILQRELDTTRTLYEGLLQRYKEVGVTGDITANNISIVDNARPPAGPSKPNLMINLALAALFGIGLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIAALVLEALDESLATPDDVEKKLGVPVLGVVPLLEKGQTTAAALADIRSGFSEAYYSLRTALQFSTPEGAPASLLVSSA
                                                                             SSA

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPAEGKSTTAYAVALNLARVGKRVLLIDGDLRNPSMHRVVGVDNDRGMSNLLSGSSDLNTVVQRTRQDNLFFIPCGPLPP
RPAEGKSTTAYAVALNLARVGKRVLLIDGDLRNPSMHRVVGVDNDRGMSNLLSGSSDLNTVVQRTRQDNLFFIPCGPLPP
    GKS                 LLIDGDLR                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPAELWGSDRFRQFLAEARNNFDHVVVDGPPVLGFADSPLLSATVGGVLFVLESRGTRRGQARGALRRLRVGRARLLGAV
NPAELWGSDRFRQFLAEARNNFDHVVVDGPPVLGFADSPLLSATVGGVLFVLESRGTRRGQARGALRRLRVGRARLLGAV
                        VVVDGPP                                                 
       730       740       750        
....:....|....:....|....:....|....:...
LTKFNAKTTTYGGYDYAYDYNYGGDHSPEAKTKKAKKA
LTKFNAKTTTYGGYDYAYDYNYGGDH            
          YGGYDYAYDYNY                

© 1998-2019