BYKdb

Annotate results for A0A0Q7KBQ4

A0A0Q7KBQ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q7KBQ4
DOMAINcd257/444SSAVPNEGKTLVATNLAMSMAQSGRSVLLIDADMRNPNVADLLGLENSVGLMTVLIGRTS
LDEATQVHDSGISFLGTGPKPPNPAEVLDTQAMRDLLHGLRSEYDVVVIDAPPMLPVADA
SILMREVDGALMLVRHGSTTREQLRLAVARIETVGGKLFGTILNRTPRRAGDVYGYGYGY
GYGQEQHE
SITEWalker A264/266GKT
SITEWalker A'284/291LLIDADMR
SITEWalker B363/369VVIDAPP
SITEY Cluster430/438YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSRWVFSVSTFVVGAVATILLVLSMSPVYGSSAKLFITSPVGQQVTDPTAAYFASQRLASYADLAREPSLLQDVINRLN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTGVTREELAGQVTAQIIATTQTLQVDVTADSAELAQQIAEAEAEGIVSLVARLEKPTSGNGSPAFVARIVGPPSISQTP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAPNVPLNIAVGLLLSLFVAIAGAVLRDLLDRTVKTRQEAEELSGGAVLATLPFDRQLKKQALTSEGHGALAEAFRVLRT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLQFANLDAKVESILVSSAVPNEGKTLVATNLAMSMAQSGRSVLLIDADMRNPNVADLLGLENSVGLMTVLIGRTSLDEA
                SSAVPNEGKTLVATNLAMSMAQSGRSVLLIDADMRNPNVADLLGLENSVGLMTVLIGRTSLDEA
                       GKT                 LLIDADMR                             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQVHDSGISFLGTGPKPPNPAEVLDTQAMRDLLHGLRSEYDVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQL
TQVHDSGISFLGTGPKPPNPAEVLDTQAMRDLLHGLRSEYDVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQL
                                          VVIDAPP                               
       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
RLAVARIETVGGKLFGTILNRTPRRAGDVYGYGYGYGYGQEQHEPIGEQARRMVGALGRGESRSSSGRRVSR
RLAVARIETVGGKLFGTILNRTPRRAGDVYGYGYGYGYGQEQHE                            
                             YGYGYGYGY                                  
© 1998-2019