BYKdb

Annotate results for A0A0Q7MSV5

A0A0Q7MSV5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7MSV5
DOMAINtad1/135MEPSEYLALLRKHWLMIAALGVLGFVGGYGYSQTIAPSYRATASLFVSEQAGSTVGESLQ
GSTYAQNRIESYAQLATKAYVLDPVIDELGLDTSARSLAHSVEATSPINSLILDISAVSG
NPEKSADIANTVSTE
DOMAINcd268/456TSSLPTEGKTTTSINLAWAMAEGGARVLLVDADLRRPSIARHLGIEGTVGLTTVLIGEAT
VADVVQRWGDMLDVLPSGQVPPNPSELLDSTTMVDLLAELASSYDVVILDSAPLLPVTDA
AVLSRLTDGALVVVGSKRVHRHQLADGLATLSTAGGRVLGLVFNRVSGKDVGATYVYGST
PQATARWHG
SITEWalker A275/277GKT
SITEWalker A'295/302LLVDADLR
SITEWalker B374/380VILDSAP
SITEY Cluster442/444YVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEPSEYLALLRKHWLMIAALGVLGFVGGYGYSQTIAPSYRATASLFVSEQAGSTVGESLQGSTYAQNRIESYAQLATKAY
MEPSEYLALLRKHWLMIAALGVLGFVGGYGYSQTIAPSYRATASLFVSEQAGSTVGESLQGSTYAQNRIESYAQLATKAY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIDELGLDTSARSLAHSVEATSPINSLILDISAVSGNPEKSADIANTVSTELARAVERIEGAGSDDTTPHVGMTVI
VLDPVIDELGLDTSARSLAHSVEATSPINSLILDISAVSGNPEKSADIANTVSTE                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPATPPSFAFTPNTKLNAVTGLVVGLAIGVVLALARTILDTRVRTQKDIRRVSDVAVLSTVRYDRKSAHEAAVMRSQPFG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQAEAYRRLRTNLRYLNLRGPNRSIVVTSSLPTEGKTTTSINLAWAMAEGGARVLLVDADLRRPSIARHLGIEGTVGLTT
                           TSSLPTEGKTTTSINLAWAMAEGGARVLLVDADLRRPSIARHLGIEGTVGLTT
                                  GKT                 LLVDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIGEATVADVVQRWGDMLDVLPSGQVPPNPSELLDSTTMVDLLAELASSYDVVILDSAPLLPVTDAAVLSRLTDGALVV
VLIGEATVADVVQRWGDMLDVLPSGQVPPNPSELLDSTTMVDLLAELASSYDVVILDSAPLLPVTDAAVLSRLTDGALVV
                                                     VILDSAP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGSKRVHRHQLADGLATLSTAGGRVLGLVFNRVSGKDVGATYVYGSTPQATARWHGTGERPQRASRRSRARRGEATPVGT
VGSKRVHRHQLADGLATLSTAGGRVLGLVFNRVSGKDVGATYVYGSTPQATARWHG                        
                                         YVY                                    
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAVFPREVPVAPVVTTPVPAPVERAEPGPDLDEIDELDTARASSKFAAHVAARVSPPTVPAAAQVTDGQVAGGTGTDQPR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASAQPAGEPAGTQASTPAGGRATNGQAGHPTAKETEGPLVATGQPTAQTAADQPASHHVRSATQDEPRPSPVAVLDDPL


       650       660       670       680       690         
....:....|....:....|....:....|....:....|....:....|....:....
DAPLTTAPSDDEATYSASVAEPSLDHDDEASRAAEPDELDAPDDLEHRIQVVPAAPWRP


© 1998-2019