BYKdb

Annotate results for A0A0Q7PFQ8

A0A0Q7PFQ8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7PFQ8
DOMAINtad1/134MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAA
SLVSSGRVASYADLATSREIMLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPD
PKAAQLIAEAHSEQ
DOMAINcd265/453TSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLVGKTS
LVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVAD
AAILARAADGALLVTRHGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYA
DEDDAANKT
SITE-321/-323GKT
SITEWalker A'292/299LLVDGDLR
SITEWalker B372/378VIIDAPP
SITEY Cluster439/443YYYYY
SITE-402/-404GKT
SITEWalker A272/274GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAASLVSSGRVASYADLATSREI
MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAASLVSSGRVASYADLATSREI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPDPKAAQLIAEAHSEQLTKFITRVDAPDRAATPIRATVADPA
MLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPDPKAAQLIAEAHSEQ                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYSSDPVSPRTLLNLVVAGLIGLVIGFGVAVLREITDNTVKTAEDVRKISGVGVVASIGYDADVPKHPLLTDLNGFAPRA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAFRVLRTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLV
                        TSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLV
                               GKT                 LLVDGDLR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKTSLVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVADAAILARAADGALLVTR
GKTSLVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVADAAILARAADGALLVTR
                                                   VIIDAPP                      
       410       420       430       440       450       460 
....:....|....:....|....:....|....:....|....:....|....:....|.
HGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYADEDDAANKTGRWVSLKP
HGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYADEDDAANKT        
                                      YYYYY                  
© 1998-2019