BYKdb

Annotate results for A0A0Q7PYQ5

A0A0Q7PYQ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7PYQ5
DOMAINtad7/263DDIDMPAVFGLLSDHKWPILIGTALFALASVIYVLFATPIYQATAVIQIQGMSANVPGQE
PGVQAAQPSQAHAATEVPLMTSRRVLGEAVNDLDLDVQARPRRFPIIGKLIAGSYRGADG
DRAASSWFGLSRYGWGGEQLKIAQLDLPGELLDVPLLLVAGEGSRYTLFDSNGRRLVEGR
VGETSRGEGVTMRLQQLVANPGTYFDVQKSSPLTAINRLYSQLEAAERGKDSGIIGLSFN
HPDPIVAEKVLEKVTKA
DOMAINcd542/730AGPSPGVGKSFVCSNLAVTIAQAGQRVLLIDADMRRGSLHRLLGVRAEDGLSELISGQIP
LEDAIRRVAGTENLSFISRGRIPPNPSELLMHANFGSLLHQLGSRYDLVIIDTPPVLAVT
DAAVIGQHAGTSLLVVRYGQNQSREIAMAKQRLEQNGVELKGAIVNGVQKGSARSAGHYV
YSYEEPLRA
SITEWalker A549/551GKS
SITEWalker A'569/576LLIDADMR
SITEWalker B650/656VIIDTPP
SITEY Cluster720/724YVYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQPQGNDDIDMPAVFGLLSDHKWPILIGTALFALASVIYVLFATPIYQATAVIQIQGMSANVPGQEPGVQAAQPSQAHAA
      DDIDMPAVFGLLSDHKWPILIGTALFALASVIYVLFATPIYQATAVIQIQGMSANVPGQEPGVQAAQPSQAHAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEVPLMTSRRVLGEAVNDLDLDVQARPRRFPIIGKLIAGSYRGADGDRAASSWFGLSRYGWGGEQLKIAQLDLPGELLDV
TEVPLMTSRRVLGEAVNDLDLDVQARPRRFPIIGKLIAGSYRGADGDRAASSWFGLSRYGWGGEQLKIAQLDLPGELLDV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLLLVAGEGSRYTLFDSNGRRLVEGRVGETSRGEGVTMRLQQLVANPGTYFDVQKSSPLTAINRLYSQLEAAERGKDSGI
PLLLVAGEGSRYTLFDSNGRRLVEGRVGETSRGEGVTMRLQQLVANPGTYFDVQKSSPLTAINRLYSQLEAAERGKDSGI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGLSFNHPDPIVAEKVLEKVTKAYVQQSVDRTSAEAKNRLQFVNEQLPKVRAELERAQAALNEFQSRNQAVDVSQQTGAI
IGLSFNHPDPIVAEKVLEKVTKA                                                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQTTALASSIAQLKVQQADINSKFTSAHPAARALMQQIGELEHEKAKLRGQLGAMPDIQRGLFRLTRDVEVSNQTYTNL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNEAQQLDIARASAIGNAFVVDAPAVDVLNPVWPKKIPLVLGATALGAFLMIAWVFVRQMFNRGVQDPSEIERLGLPVYA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIMLSQKERVEAPRLNARQPSNRPKLLALRAPSDMAMEALRSLRTSLHFARMETRNNLLMIAGPSPGVGKSFVCSNLAVT
                                                             AGPSPGVGKSFVCSNLAVT
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAQAGQRVLLIDADMRRGSLHRLLGVRAEDGLSELISGQIPLEDAIRRVAGTENLSFISRGRIPPNPSELLMHANFGSLL
IAQAGQRVLLIDADMRRGSLHRLLGVRAEDGLSELISGQIPLEDAIRRVAGTENLSFISRGRIPPNPSELLMHANFGSLL
        LLIDADMR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HQLGSRYDLVIIDTPPVLAVTDAAVIGQHAGTSLLVVRYGQNQSREIAMAKQRLEQNGVELKGAIVNGVQKGSARSAGHY
HQLGSRYDLVIIDTPPVLAVTDAAVIGQHAGTSLLVVRYGQNQSREIAMAKQRLEQNGVELKGAIVNGVQKGSARSAGHY
         VIIDTPP                                                               Y
       730 
....:....|.
VYSYEEPLRAA
VYSYEEPLRA 
VYSY       

© 1998-2019