BYKdb

Annotate results for A0A0Q7QDF6

A0A0Q7QDF6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q7QDF6
DOMAINcd263/452TSSVAGEGKTTTASNLAISLAQSGQNVVLVDGDLRRPRLHEVFGAEQNVGLTSVLVGKVP
LDSAVQGTDVPGLDVLTSGTRPPNPSEIIQTAAMETVLIELGRRYDIVLVDAPPLLPVAD
AALLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSPKKETARYGYGYG
YDDGKGRRRR
SITEWalker A270/272GKT
SITEWalker A'290/297VLVDGDLR
SITEWalker B370/376VLVDAPP
SITEY Cluster437/443YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSRSGWTAVARRWPLVVLLGALGLGAAALVLSGQTTRYDGSAEVLIQPTSPATSLSGRAVESYAHVLGGTALEQRAVKA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLEDAGDAEVRGEVVGNSSVVRVVVRTTDPERAAQLAGQVAEELVSWIASYQDRAAERAGEDAPDLPTLSPIVIQEGTA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQPVEPDARRTYVLFGLAGLLLGLLLAALRNLATATVTSSDALTEQVKAPVIGAVAQDRHVADHPLISTLSNQHPRAEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRIIRTNLQFLDVDRVSNVYVVTSSVAGEGKTTTASNLAISLAQSGQNVVLVDGDLRRPRLHEVFGAEQNVGLTSVLVGK
                      TSSVAGEGKTTTASNLAISLAQSGQNVVLVDGDLRRPRLHEVFGAEQNVGLTSVLVGK
                             GKT                 VLVDGDLR                       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPLDSAVQGTDVPGLDVLTSGTRPPNPSEIIQTAAMETVLIELGRRYDIVLVDAPPLLPVADAALLSVISDGAILVVRHG
VPLDSAVQGTDVPGLDVLTSGTRPPNPSEIIQTAAMETVLIELGRRYDIVLVDAPPLLPVADAALLSVISDGAILVVRHG
                                                 VLVDAPP                        
       410       420       430       440       450  
....:....|....:....|....:....|....:....|....:....|..
RTGHDQVRAASERITTVGGRLLGTIISMSPKKETARYGYGYGYDDGKGRRRR
RTGHDQVRAASERITTVGGRLLGTIISMSPKKETARYGYGYGYDDGKGRRRR
                                    YGYGYGY         
© 1998-2019