BYKdb

Annotate results for A0A0Q7QIS8

A0A0Q7QIS8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q7QIS8
DOMAINtad3/137KYVELRQFFGTLQARWKFALVAFLLGTIATVALVFTMAPQYGSTVKIFMSTPGGGTTEYV
AAYTLQQRVASYADLAVDPAVLDTVVTRLDLDETPQELAGQISATVVTGTNNIQIDVTAD
TAEQAQLIAGAEADA
DOMAINcd268/456SSALPNEGKTLTATNLAISMAQSGRSVLLIDADMRNPNVAELLGLENSVGLLSVLVGRTT
IEQAIQPHVSGISFMGTGPAAPNPAEVLESRAMRDLLSRVRKEFDTVIIDAPPMLPVADA
SILLTEVDGALLLVRHGSTTREQLRLAVERVETVGGRLFGCVLNRTPRRASDDAYGYGYG
HGYGYGSAL
SITEWalker A275/277GKT
SITEWalker A'295/302LLIDADMR
SITEWalker B374/380VIIDAPP
SITEY Cluster442/452YGYGYGHGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKYVELRQFFGTLQARWKFALVAFLLGTIATVALVFTMAPQYGSTVKIFMSTPGGGTTEYVAAYTLQQRVASYADLAVD
  KYVELRQFFGTLQARWKFALVAFLLGTIATVALVFTMAPQYGSTVKIFMSTPGGGTTEYVAAYTLQQRVASYADLAVD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVLDTVVTRLDLDETPQELAGQISATVVTGTNNIQIDVTADTAEQAQLIAGAEADAIVALVKRLERPSASGQTAAVTAR
PAVLDTVVTRLDLDETPQELAGQISATVVTGTNNIQIDVTADTAEQAQLIAGAEADA                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAADPSFRSSPVAPNVPLNLAAGLLVSLFVAIAGALVRDLLDRTVKSRRDVETITSSAVLATLPFYPQVKKEPLSAETGG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAEAFRVLRTNLQFVKLDADRQAILVSSALPNEGKTLTATNLAISMAQSGRSVLLIDADMRNPNVAELLGLENSVGLLS
                           SSALPNEGKTLTATNLAISMAQSGRSVLLIDADMRNPNVAELLGLENSVGLLS
                                  GKT                 LLIDADMR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLVGRTTIEQAIQPHVSGISFMGTGPAAPNPAEVLESRAMRDLLSRVRKEFDTVIIDAPPMLPVADASILLTEVDGALLL
VLVGRTTIEQAIQPHVSGISFMGTGPAAPNPAEVLESRAMRDLLSRVRKEFDTVIIDAPPMLPVADASILLTEVDGALLL
                                                     VIIDAPP                    
       410       420       430       440       450       460       470        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
VRHGSTTREQLRLAVERVETVGGRLFGCVLNRTPRRASDDAYGYGYGHGYGYGSALPTAVKPEQVQKSGDEASTLSRS
VRHGSTTREQLRLAVERVETVGGRLFGCVLNRTPRRASDDAYGYGYGHGYGYGSAL                      
                                         YGYGYGHGYGY                          
© 1998-2019