BYKdb

Annotate results for A0A0Q7T431

A0A0Q7T431 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q7T431
DOMAINcd47/226ASAQAGEGKTTTISNLAVTYAQEGKKVLLIDADLRNPSLHQVFSVPNHIGLSSVLSNQYD
VDEVLRESYIENLQLFTSGPIPPNPSEMIGSNRMKNLMNDLQSKYDVIMFDTPPVLAVTD
ALIVSSFCDGVLLVVNSGKVKKELVKKTKAHLEHVNARILGAILNNIKTTSNSVSYYGEK
SITEWalker A54/56GKT
SITEWalker A'74/81LLIDADLR
SITEWalker B154/160IMFDTPP
SITEY Cluster222/223YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRLTNENNNLVTYFNSKSHISEGYRKLRTNIQFSSIDSHIKTIMVASAQAGEGKTTTISNLAVTYAQEGKKVLLIDADL
                                              ASAQAGEGKTTTISNLAVTYAQEGKKVLLIDADL
                                                     GKT                 LLIDADL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNPSLHQVFSVPNHIGLSSVLSNQYDVDEVLRESYIENLQLFTSGPIPPNPSEMIGSNRMKNLMNDLQSKYDVIMFDTPP
RNPSLHQVFSVPNHIGLSSVLSNQYDVDEVLRESYIENLQLFTSGPIPPNPSEMIGSNRMKNLMNDLQSKYDVIMFDTPP
R                                                                        IMFDTPP
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
VLAVTDALIVSSFCDGVLLVVNSGKVKKELVKKTKAHLEHVNARILGAILNNIKTTSNSVSYYGEK
VLAVTDALIVSSFCDGVLLVVNSGKVKKELVKKTKAHLEHVNARILGAILNNIKTTSNSVSYYGEK
                                                             YY   
© 1998-2019