BYKdb

Annotate results for A0A0Q8BY08

A0A0Q8BY08 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8BY08
DOMAINtad23/206FSIDFDWLLGVAKRQWKIVAATVVVFVALGIAYVLTAVPLYQATTNILIDRANTVVVEQL
SKFGENVDDDASVLSQVELLKSSAITMGTVDKLKLDEDPVFMASDDGVITQLKNFVRSLL
NVSTWFVSDTVTNDDKDRMRQNASDKVRNNMDVSRTGKSYVLALNFVSPSKELSARIANG
IAEA
DOMAINcd565/755VSTLPGEGKSTIAVNLSELLASQGSRTVLVDADLRNPGATRAIARHAEKGLVEAIFEQAS
LEECLLRSKRSNLAFLPAVMKQRLPHSAELLSSAAMRHLLNRISDHADYIIVDLPPLAPV
VDARAMAGSVDAFVYVTEWGRVARRMVRQTLQAEPRIYEKCLGVVLNKVDMNRMKLYQTF
GSAEYYHSSYS
SITEWalker A572/574GKS
SITEWalker A'592/599VLVDADLR
SITEWalker B674/680IIVDLPP
SITEY Cluster749/758YYHSSYSNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDARNTSLTVKHEGSSEDQASDFSIDFDWLLGVAKRQWKIVAATVVVFVALGIAYVLTAVPLYQATTNILIDRANTVVVE
                      FSIDFDWLLGVAKRQWKIVAATVVVFVALGIAYVLTAVPLYQATTNILIDRANTVVVE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSKFGENVDDDASVLSQVELLKSSAITMGTVDKLKLDEDPVFMASDDGVITQLKNFVRSLLNVSTWFVSDTVTNDDKDR
QLSKFGENVDDDASVLSQVELLKSSAITMGTVDKLKLDEDPVFMASDDGVITQLKNFVRSLLNVSTWFVSDTVTNDDKDR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRQNASDKVRNNMDVSRTGKSYVLALNFVSPSKELSARIANGIAEAYLNDKLDAKYDATRRASDWLQDRIAELKQKALES
MRQNASDKVRNNMDVSRTGKSYVLALNFVSPSKELSARIANGIAEA                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLAVQKFRTANGLVSTGTQLVSDQQLTELNSALIASQADVASKMARFDRIQQIIKDGQMDAIVTDVLASTISNDLRSKYL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASKRADQLAAILGPDHESVVRQRNEMADYKRQMFDELGRIAESYKSDVDVAKAREKSLKDSVTQATSVSAGANETMVQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RELERSSETYKNLYQSFLQKFQEAVQQQSFPVTEARIISPAVVPTTPAYPRKTLVVALFAILGAAAGSGIGMFREYRDRF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRTAEQVRDVLGLETLGTAPLISKIGKPIDKVGPEPSEREIRKSSAVMDYVLDHPLSPFAEAMRSVKIAADMVLPSASCR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIGVVSTLPGEGKSTIAVNLSELLASQGSRTVLVDADLRNPGATRAIARHAEKGLVEAIFEQASLEECLLRSKRSNLAFL
    VSTLPGEGKSTIAVNLSELLASQGSRTVLVDADLRNPGATRAIARHAEKGLVEAIFEQASLEECLLRSKRSNLAFL
           GKS                 VLVDADLR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVMKQRLPHSAELLSSAAMRHLLNRISDHADYIIVDLPPLAPVVDARAMAGSVDAFVYVTEWGRVARRMVRQTLQAEPR
PAVMKQRLPHSAELLSSAAMRHLLNRISDHADYIIVDLPPLAPVVDARAMAGSVDAFVYVTEWGRVARRMVRQTLQAEPR
                                 IIVDLPP                                        
       730       740       750       760 
....:....|....:....|....:....|....:....|.
IYEKCLGVVLNKVDMNRMKLYQTFGSAEYYHSSYSNYYREG
IYEKCLGVVLNKVDMNRMKLYQTFGSAEYYHSSYS      
                            YYHSSYSNYY   

© 1998-2019