BYKdb

Annotate results for A0A0Q8CQ58

A0A0Q8CQ58 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8CQ58
DOMAINtad1/131MYLSALRRRWPLIIILGILGAAVAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNF
AQANVQSYARLATTPLVLQPVIDELDLDTSVNGLASVISADTPLNTVIIQITVQNSDPAR
AAMIADAVTSS
DOMAINcd263/451TSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIADRCGLEGSVGLTTVLLGKIS
VADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSKTYDFVVIDTPPLLAATDT
LGLAHATDGAIVVVKYKSTRRQQLAEAVGSMRTVNARLLGVVFDRIPTPKAIEYYSYHAK
HSNGSADLT
SITEWalker A270/272GKS
SITEWalker A'290/297LLIDGDLR
SITE-423/-429VVFDRIP
SITEY Cluster436/439YYSY
SITEWalker B369/375VVIDTPP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYLSALRRRWPLIIILGILGAAVAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNFAQANVQSYARLATTPLVLQP
MYLSALRRRWPLIIILGILGAAVAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNFAQANVQSYARLATTPLVLQP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDELDLDTSVNGLASVISADTPLNTVIIQITVQNSDPARAAMIADAVTSSLSTVVEKISPTSADKTPAVKMTQIASAQV
VIDELDLDTSVNGLASVISADTPLNTVIIQITVQNSDPARAAMIADAVTSS                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAAPFAPNTRLIVATGLAVGLALGLVLALIWELLDTRVRSEKELTAITGLPVLGAVAKGPSKKPGWIAMRSDSHSMQAES


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YRRIRANLEFADIERAVRSVIVTSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIADRCGLEGSVGLTTVLLGK
                      TSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIADRCGLEGSVGLTTVLLGK
                             GKS                 LLIDGDLR                       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISVADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSKTYDFVVIDTPPLLAATDTLGLAHATDGAIVVVKYKS
ISVADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSKTYDFVVIDTPPLLAATDTLGLAHATDGAIVVVKYKS
                                                VVIDTPP                         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRRQQLAEAVGSMRTVNARLLGVVFDRIPTPKAIEYYSYHAKHSNGSADLTASGLDEVDETAPSTIAPAAQPESPVPAED
TRRQQLAEAVGSMRTVNARLLGVVFDRIPTPKAIEYYSYHAKHSNGSADLT                             
                                   YYSY                                         
       490       500       510       520       
....:....|....:....|....:....|....:....|....:..
VEPAREPAPSAEPQAVAPTVTRTKKTRRARSDVIHTSDAGATVVVES


© 1998-2019