BYKdb

Annotate results for A0A0Q8FX35

A0A0Q8FX35 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8FX35
DOMAINtad20/197ETIDVERLIAAFRRRLWLFLAVAGVIAAVLLFVMLRQTPMYTATANVMINTRTEKVVDSQ
AVLSGLTADTGTVDTEVEVLKSPQLAAAVVNDLKLDKDPEFNAALQPPGLVGSILGGKKA
ADERAAPGAAEAEKQAVIAAVGKQLTVRRVGLTYSITISFQSTSAMKSATIANAFADA
DOMAINcd544/736TSALPGEGKTTTSICLARVAAQAGSKVLLLDCDLRRRAVTRTLGLTPETGLAEVLHGTTP
LESAVVLDQTSGAYVLPLAHSASSTEDIFGLPAMDQLLARARASFDLVILDTAPVLALAD
TRILAGKTDLVVLLARWRKTPARAIGASVRLLQQANAQIAGVALTQVDMNAQSKHGYGDA
GYYYDEYKKYYAS
SITE-669/-671GKT
SITEWalker A'571/578LLLDCDLR
SITEWalker B651/657VILDTAP
SITEY Cluster720/734YGDAGYYYDEYKKYY
SITEWalker A551/553GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENSVDTQPLTSRARGSSGETIDVERLIAAFRRRLWLFLAVAGVIAAVLLFVMLRQTPMYTATANVMINTRTEKVVDSQA
                   ETIDVERLIAAFRRRLWLFLAVAGVIAAVLLFVMLRQTPMYTATANVMINTRTEKVVDSQA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSGLTADTGTVDTEVEVLKSPQLAAAVVNDLKLDKDPEFNAALQPPGLVGSILGGKKAADERAAPGAAEAEKQAVIAAV
VLSGLTADTGTVDTEVEVLKSPQLAAAVVNDLKLDKDPEFNAALQPPGLVGSILGGKKAADERAAPGAAEAEKQAVIAAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKQLTVRRVGLTYSITISFQSTSAMKSATIANAFADAYLRSQLTAKFDATRQANSFLNTRLDTLRTQLQEADAAVSNYRV
GKQLTVRRVGLTYSITISFQSTSAMKSATIANAFADA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANNLLSSEGTTLTEQEISAYNQQLAQARAQQAEDEARLRTARAQLAAGSNGDDVGEALSSQVVQNLRAQRAVVSGRVAEM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSRYGDRHPDMLRAQRELADIDQQIQAEIRRIVSNLEARVRVSQQRTASVEASLGGARGTLAANSAASVHLKELEGNAEA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARTVYQNFLDRYKQTGAQEGVEQADARVVSRAVPPTHQSSPNVLLALALSIIVGAGAGLAAVVIAEIMDAGLATSDDVER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIGLASIASIPLMSSVAEPNERGIPPIDYVLRKPLSGFAEAFRSLRTSILYAVPGQQGKIVVLTSALPGEGKTTTSICLA
                                                               TSALPGEGKTTTSICLA
                                                                      GKT       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVAAQAGSKVLLLDCDLRRRAVTRTLGLTPETGLAEVLHGTTPLESAVVLDQTSGAYVLPLAHSASSTEDIFGLPAMDQL
RVAAQAGSKVLLLDCDLRRRAVTRTLGLTPETGLAEVLHGTTPLESAVVLDQTSGAYVLPLAHSASSTEDIFGLPAMDQL
          LLLDCDLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LARARASFDLVILDTAPVLALADTRILAGKTDLVVLLARWRKTPARAIGASVRLLQQANAQIAGVALTQVDMNAQSKHGY
LARARASFDLVILDTAPVLALADTRILAGKTDLVVLLARWRKTPARAIGASVRLLQQANAQIAGVALTQVDMNAQSKHGY
          VILDTAP                                                              Y
       730      
....:....|....:.
GDAGYYYDEYKKYYAS
GDAGYYYDEYKKYYAS
GDAGYYYDEYKKYY  

© 1998-2019