BYKdb

Annotate results for A0A0Q8J618

A0A0Q8J618 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8J618
DOMAINtad16/272DEIDLAALLGTLLDHRWLIGIVTAAGFALSLMYVLLASPVYQANAMVQVESNSPTLPGLT
AVSQALTDSAPQAVTEIALMTSRTVVGKAVDDLKLDVQVEPKRFPLIGSLLARRYQPAAP
GDLASPWLGMNSYGWGGDTLALSQLSVPEELVAKPLLLVAAEAGAYALYDDEDNLLLNGK
VGEKASAGTVSLRVEQMSAHPGMRFEITQLPRLAILTSLQNNLTASEKAKDSGIIQLSYE
NGDPDLAVATLDAITRQ
DOMAINcd556/742CGSSPGAGKTFVSTNLAAVITQGGQRVLLIDGDMRRGTLHRVMGHSNDNGLADLLAGKID
LATATRASAIDGLHFIPRGEAPPNPSELLMRPNLAALLQTTAQQYDLVIVDTPPILAVTD
AAIIGRHAATSLMVARFGLNPAKELALAKQRFEHNGIELRGAIFNAVERRHDTHYVYGYQ
YQGKTDA
SITE-738/-740GKT
SITEWalker A'583/590LLIDGDMR
SITEWalker B663/669VIVDTPP
SITEY Cluster730/736YVYGYQY
SITEWalker A563/565GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSAVSTPPGSRQDSNDEIDLAALLGTLLDHRWLIGIVTAAGFALSLMYVLLASPVYQANAMVQVESNSPTLPGLTAVSQA
               DEIDLAALLGTLLDHRWLIGIVTAAGFALSLMYVLLASPVYQANAMVQVESNSPTLPGLTAVSQA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTDSAPQAVTEIALMTSRTVVGKAVDDLKLDVQVEPKRFPLIGSLLARRYQPAAPGDLASPWLGMNSYGWGGDTLALSQL
LTDSAPQAVTEIALMTSRTVVGKAVDDLKLDVQVEPKRFPLIGSLLARRYQPAAPGDLASPWLGMNSYGWGGDTLALSQL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVPEELVAKPLLLVAAEAGAYALYDDEDNLLLNGKVGEKASAGTVSLRVEQMSAHPGMRFEITQLPRLAILTSLQNNLTA
SVPEELVAKPLLLVAAEAGAYALYDDEDNLLLNGKVGEKASAGTVSLRVEQMSAHPGMRFEITQLPRLAILTSLQNNLTA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEKAKDSGIIQLSYENGDPDLAVATLDAITRQYTRQNVERNSAEAASSLQFVQRQLPNVRADLEKAEHALAEYQSQAHTV
SEKAKDSGIIQLSYENGDPDLAVATLDAITRQ                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVTLEAKSLLDQVVALDNNVSQLKLQQAEVSRRFTPQHPAYRALMAQLGELEGKKQEINDRIGGLPQTQQQLLGLTREVQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSTLTYTNLLNQAQQLDIARAGTVGNARVVDKSVVDVSQPIKPKRLQLLVIGTFLAGFLAVAWVFLRQMLNRGIEDVKQI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EELGLPVYASIPMSDYQRDHESNGRKLHGSGNGRSNRPHLLALDAPSDLAIEAIRSLRTSLHFARLEAKNNILMICGSSP
                                                                           CGSSP

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGKTFVSTNLAAVITQGGQRVLLIDGDMRRGTLHRVMGHSNDNGLADLLAGKIDLATATRASAIDGLHFIPRGEAPPNP
GAGKTFVSTNLAAVITQGGQRVLLIDGDMRRGTLHRVMGHSNDNGLADLLAGKIDLATATRASAIDGLHFIPRGEAPPNP
  GKT                 LLIDGDMR                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELLMRPNLAALLQTTAQQYDLVIVDTPPILAVTDAAIIGRHAATSLMVARFGLNPAKELALAKQRFEHNGIELRGAIFN
SELLMRPNLAALLQTTAQQYDLVIVDTPPILAVTDAAIIGRHAATSLMVARFGLNPAKELALAKQRFEHNGIELRGAIFN
                      VIVDTPP                                                   
       730       740  
....:....|....:....|..
AVERRHDTHYVYGYQYQGKTDA
AVERRHDTHYVYGYQYQGKTDA
         YVYGYQY      

© 1998-2019