BYKdb

Annotate results for A0A0Q8LJ68

A0A0Q8LJ68 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8LJ68
DOMAINtad6/142SQVTPGRILGVLLRAWWVILLAGLLGGLLAFGYSSTLSPIYQSTASTYFSMRSASSGSDI
NQGSAYTQSQMLSFAQLAMSSVVLDAVRDDLDTDLTNSQIRNMTTVTIPQNTVILDVTAA
STQPEFAAELANSIADN
DOMAINcd273/461TSSIPGEGKTSTAVNLALTYAEAGLRVLLVDADLRRPMVAETLGLENSVGLTTMLVGAVD
FEEASLPWGDTSLWVLPAGEVPPNPAELLASARMTELLRELRGKFDVMVVDTAPLLSVSD
ATIIAQSVDTTIVVADVSKVHLAQLSRSLEALDRARAEVAGVLFSRVKRQRGDDYNYYYG
PSGGKRQRT
SITEWalker A280/282GKT
SITEWalker A'300/307LLVDADLR
SITEWalker B380/386MVVDTAP
SITEY Cluster447/451YNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADIRSQVTPGRILGVLLRAWWVILLAGLLGGLLAFGYSSTLSPIYQSTASTYFSMRSASSGSDINQGSAYTQSQMLSFA
     SQVTPGRILGVLLRAWWVILLAGLLGGLLAFGYSSTLSPIYQSTASTYFSMRSASSGSDINQGSAYTQSQMLSFA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLAMSSVVLDAVRDDLDTDLTNSQIRNMTTVTIPQNTVILDVTAASTQPEFAAELANSIADNLAEVVDEISPKDDAGNAT
QLAMSSVVLDAVRDDLDTDLTNSQIRNMTTVTIPQNTVILDVTAASTQPEFAAELANSIADN                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVARVIEPATPAAFQSSPNKQRDAVLGAFAGVLLAVLAIVVWTLLDTRVRSEDALRRITDLPVLGGIPRRKDAQRRALVV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEPNSTSAEAYRRVRSSLRFAAVEHDIRAIAVTSSIPGEGKTSTAVNLALTYAEAGLRVLLVDADLRRPMVAETLGLENS
                                TSSIPGEGKTSTAVNLALTYAEAGLRVLLVDADLRRPMVAETLGLENS
                                       GKT                 LLVDADLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGLTTMLVGAVDFEEASLPWGDTSLWVLPAGEVPPNPAELLASARMTELLRELRGKFDVMVVDTAPLLSVSDATIIAQSV
VGLTTMLVGAVDFEEASLPWGDTSLWVLPAGEVPPNPAELLASARMTELLRELRGKFDVMVVDTAPLLSVSDATIIAQSV
                                                           MVVDTAP              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTTIVVADVSKVHLAQLSRSLEALDRARAEVAGVLFSRVKRQRGDDYNYYYGPSGGKRQRTGVPLTRRERRGEATPTSVP
DTTIVVADVSKVHLAQLSRSLEALDRARAEVAGVLFSRVKRQRGDDYNYYYGPSGGKRQRT                   
                                              YNYYY                             
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDIAPAGSLPAPAPSPSPPDDAPEIEVEDNARHEDAPSAEGADAVQSPDVSSDLGEAEDDANALDLSRVEGDVRLTADRS


  
..
DS


© 1998-2019