BYKdb

Annotate results for A0A0Q8Q033

A0A0Q8Q033 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8Q033
DOMAINtad10/145WVLDFKQFLVVLRRRWVSVLLLIALALGVAAGITFTRTPMYESKSQVFLSIDVRNTTDAY
AASLFASNRAASYAKLAKSTALSERVIEQLNLDMTPEKLADRIDAEVVELTSLIEIKVKD
ENARDAQKIGDVVTEE
DOMAINcd277/465TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVATTLGLDPAIGLTTALVGKTE
IHDAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIRRLRSSYDMVIIDAPPLLPVAD
ASVLAKLADGVIIVARHGKTTKDQVNEAINRLNQVGARLYGVVVNMVAKRAIGSYYYYYY
EESGPSGRG
SITE-333/-335GKT
SITEWalker A'304/311LIIDADLR
SITEWalker B384/390VIIDAPP
SITEY Cluster451/456YYYYYY
SITE-414/-416GKT
SITE-467/-469GKS
SITE-472/-474GKS
SITEWalker A284/286GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAHGTDSKGWVLDFKQFLVVLRRRWVSVLLLIALALGVAAGITFTRTPMYESKSQVFLSIDVRNTTDAYAASLFASNRAA
         WVLDFKQFLVVLRRRWVSVLLLIALALGVAAGITFTRTPMYESKSQVFLSIDVRNTTDAYAASLFASNRAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYAKLAKSTALSERVIEQLNLDMTPEKLADRIDAEVVELTSLIEIKVKDENARDAQKIGDVVTEEFTKFVPGLETAGGQS
SYAKLAKSTALSERVIEQLNLDMTPEKLADRIDAEVVELTSLIEIKVKDENARDAQKIGDVVTEE               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESQINAQITDEASYEPDQVSPTVLLNMIVAALIGLVLGIGLAVARELLDRTIRTADHVAELTDSPVLASIGFDNDIRSAP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLTDLGGFAARTEAFRLLRTNLQFIDLDHQPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVATTLG
                                    TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVATTLG
                                           GKT                 LIIDADLR         
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDPAIGLTTALVGKTEIHDAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIRRLRSSYDMVIIDAPPLLPVADASVL
LDPAIGLTTALVGKTEIHDAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIRRLRSSYDMVIIDAPPLLPVADASVL
                                                               VIIDAPP          
       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
AKLADGVIIVARHGKTTKDQVNEAINRLNQVGARLYGVVVNMVAKRAIGSYYYYYYEESGPSGRGSGKSSSGKSGRRRA
AKLADGVIIVARHGKTTKDQVNEAINRLNQVGARLYGVVVNMVAKRAIGSYYYYYYEESGPSGRG              
                                                  YYYYYY                       
© 1998-2019