BYKdb

Annotate results for A0A0Q8Q8E3

A0A0Q8Q8E3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8Q8E3
DOMAINtad17/277ETLDVAKYLSVLYDSRWLIIACTCLAIIAGLVYTISATPIYRANILIKVDPGTGRAKNVL
GDLASPSDMNFDIKSAVAAEMEVLRSRAVVSKAVDAGKFYIDVRPKYLPVFGRWLAKRNK
GLSEPGLLGYGGYVWGKEEATVSQFDVPEELEGHAFTLKALADGKYELTSPDHGVIGSGR
VGVSQRFPFGDKSIVLMVDQLNARPEAEFTAIRYTRADTIERLQEGLKISEKGKQSGIIE
ATLDGPNPHLTMRILDGVSRE
DOMAINcd551/731TGATSGVGKSFVSANFAVVLASIGKKVLVVDSDLRSGHLHHYFGVRREGGLADVVTGKTM
LNHAIHHDVAENVDFIANGSPTDKPAELLANENYGKLLQLLSTRYDYVLIDTAPILEVSD
ALSVAPHAGAIYNIVRGGKSTAHEVEEATKYLNQAGHTVTGLVLNDSKARHSRYGYGGAY
A
SITEWalker A558/560GKS
SITEWalker A'578/585LVVDSDLR
SITEWalker B658/664VLIDTAP
SITE-655/-657YDY
SITE-607/-609GKT
SITEY Cluster724/730YGYGGAY
SITE-688/-690GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQATLQLTSSSPKEKETLDVAKYLSVLYDSRWLIIACTCLAIIAGLVYTISATPIYRANILIKVDPGTGRAKNVLGDLA
                ETLDVAKYLSVLYDSRWLIIACTCLAIIAGLVYTISATPIYRANILIKVDPGTGRAKNVLGDLA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPSDMNFDIKSAVAAEMEVLRSRAVVSKAVDAGKFYIDVRPKYLPVFGRWLAKRNKGLSEPGLLGYGGYVWGKEEATVSQ
SPSDMNFDIKSAVAAEMEVLRSRAVVSKAVDAGKFYIDVRPKYLPVFGRWLAKRNKGLSEPGLLGYGGYVWGKEEATVSQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDVPEELEGHAFTLKALADGKYELTSPDHGVIGSGRVGVSQRFPFGDKSIVLMVDQLNARPEAEFTAIRYTRADTIERLQ
FDVPEELEGHAFTLKALADGKYELTSPDHGVIGSGRVGVSQRFPFGDKSIVLMVDQLNARPEAEFTAIRYTRADTIERLQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGLKISEKGKQSGIIEATLDGPNPHLTMRILDGVSREYVRQNVYQKSEEAEKMLAFLNTQLPQLKQDLEQSESKYNSLRN
EGLKISEKGKQSGIIEATLDGPNPHLTMRILDGVSRE                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRGTVDLGEEAKSMLQQSVYTQTKMVELRQRKEELLNRFEETHPAVETINQQMRELKRDLATVDARIKRLPEVEQNVVRL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRDVRINTELYTSLLSTAQQLRVASESKVGTARLLDSAVVPHKPVKPKGALILGAAGIGGILLGILAAIGRKTLYRQIDA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQDIEQLLGMPVAANIPHSMVSPKLIGRSNSRPPILPLNDAANDTAESLRRFRNFLQHSMVNAKSNIIMITGATSGVGKS
                                                                      TGATSGVGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVSANFAVVLASIGKKVLVVDSDLRSGHLHHYFGVRREGGLADVVTGKTMLNHAIHHDVAENVDFIANGSPTDKPAELLA
FVSANFAVVLASIGKKVLVVDSDLRSGHLHHYFGVRREGGLADVVTGKTMLNHAIHHDVAENVDFIANGSPTDKPAELLA
                 LVVDSDLR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NENYGKLLQLLSTRYDYVLIDTAPILEVSDALSVAPHAGAIYNIVRGGKSTAHEVEEATKYLNQAGHTVTGLVLNDSKAR
NENYGKLLQLLSTRYDYVLIDTAPILEVSDALSVAPHAGAIYNIVRGGKSTAHEVEEATKYLNQAGHTVTGLVLNDSKAR
                 VLIDTAP                                                        
       730 
....:....|.
HSRYGYGGAYA
HSRYGYGGAYA
   YGYGGAY 

© 1998-2019