BYKdb

Annotate results for A0A0Q8RB63

A0A0Q8RB63 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8RB63
DOMAINtad1/159MGLAHLANVFHRRRWLILGTIAVTMIVTIVSIAMQTPLYEATATLRMDIPVATDGTERSM
PTAESEMQIETETRTLASHDFASAMVRDLELLDNPAFSGRKISKGRTARAPQSRIDKAAD
RLLTTIKVQRVPHTQLINVSVQSPYPTFAAMVANRYVQI
DOMAINcd512/699TSPFPGDGKTAVAHSLGATAIAAGRSAVVIDLDLRRTPGEGMLEADAANLSPYLEGLAPL
QGLLPSPSDSPAKSLLVLSAYKETRDPNAVLASPQLARLFDELRERVDLIIIDAPPVLAV
HDASNMLPLAEMTLLVVRWGRTRIDEVAGALAALREPVSGVVLNAVDYRRHAQGRYGDMV
QYFRRSRA
SITEWalker A519/521GKT
SITEWalker A'539/546VVIDLDLR
SITEWalker B621/627IIIDAPP
SITEY Cluster687/701YGDMVQYFRRSRAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLAHLANVFHRRRWLILGTIAVTMIVTIVSIAMQTPLYEATATLRMDIPVATDGTERSMPTAESEMQIETETRTLASHD
MGLAHLANVFHRRRWLILGTIAVTMIVTIVSIAMQTPLYEATATLRMDIPVATDGTERSMPTAESEMQIETETRTLASHD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FASAMVRDLELLDNPAFSGRKISKGRTARAPQSRIDKAADRLLTTIKVQRVPHTQLINVSVQSPYPTFAAMVANRYVQIR
FASAMVRDLELLDNPAFSGRKISKGRTARAPQSRIDKAADRLLTTIKVQRVPHTQLINVSVQSPYPTFAAMVANRYVQI 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QMHGALDRLQRQDKIIAKLAERTRQAGDELRKAEQEVADFRRANHMLVGAAGPGDLAQLNQLTSDAAAAASARAGAAAKA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGVGAAARMRTGSENATSPLLSMQEQRYAELLQRQAELSSFYGPGHPSLANVLAQIQEVKASLEAERTRVRQVAAAEAAM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSRETYLARSDAQDAAAREAALQRSLSALTLKAYDNAAGNVRLAELERTAETQRALYVGLAARLKQLGSALVSGTGLVL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSTAPVPVTPISPTPRKTLMVMLLGSAILGFACAFALEMTDQRLRSGQQIWRLFGLRSFAMIPLMRSGVTRADAGRMLSE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPNSIFAEAARTLHTEIVRRRHGPGAQVVLITSPFPGDGKTAVAHSLGATAIAAGRSAVVIDLDLRRTPGEGMLEADAAN
                               TSPFPGDGKTAVAHSLGATAIAAGRSAVVIDLDLRRTPGEGMLEADAAN
                                      GKT                 VVIDLDLR              
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSPYLEGLAPLQGLLPSPSDSPAKSLLVLSAYKETRDPNAVLASPQLARLFDELRERVDLIIIDAPPVLAVHDASNMLPL
LSPYLEGLAPLQGLLPSPSDSPAKSLLVLSAYKETRDPNAVLASPQLARLFDELRERVDLIIIDAPPVLAVHDASNMLPL
                                                            IIIDAPP             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEMTLLVVRWGRTRIDEVAGALAALREPVSGVVLNAVDYRRHAQGRYGDMVQYFRRSRAYYPRDDELLQPTFLDRLLRRF
AEMTLLVVRWGRTRIDEVAGALAALREPVSGVVLNAVDYRRHAQGRYGDMVQYFRRSRA                     
                                              YGDMVQYFRRSRAYY                   
      
....:.
RPACDR


© 1998-2019