BYKdb

Annotate results for A0A0Q8RID2

A0A0Q8RID2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8RID2
DOMAINtad14/189VPPILKQYWHTAVRWRWLIGAVIAGALAIGLIITLLTPSSYTAKVQIEISRDQKKVTNVQ
GLDSATADRDLEFYETQYALLQSRSLGQRVAKHLGLARRDEFFTAHGVTLDSEKFGASGR
SNLTAKQVAAREKMASRLLLNNIEVEPVRRSRLVNLTYTSRSPGISAEVVNAWSTQ
DOMAINcd529/718TSTQPAEGKSTTSYALARIIGRTGKSVLLVDGDMRSPDVHHLLGLDNAAGLSNALAGDDN
VSALIRTTPYRGVSVLTSGPTPPSAAELLSSDRIRHIVNELQGLYDHVVIDAPPILGLSD
APLLGRAVEGAVLVIQAEGAAVRGIRAAISRLRMVNTHIFGTVLTKLKASELAYGYGYGY
GYGYSYGDNA
SITE-552/-554GKS
SITEWalker A'556/563LLVDGDMR
SITEWalker B636/642VVIDAPP
SITEY Cluster702/714YGYGYGYGYGYSY
SITEWalker A536/538GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEGQNPHANDSYAVPPILKQYWHTAVRWRWLIGAVIAGALAIGLIITLLTPSSYTAKVQIEISRDQKKVTNVQGLDSATA
             VPPILKQYWHTAVRWRWLIGAVIAGALAIGLIITLLTPSSYTAKVQIEISRDQKKVTNVQGLDSATA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRDLEFYETQYALLQSRSLGQRVAKHLGLARRDEFFTAHGVTLDSEKFGASGRSNLTAKQVAAREKMASRLLLNNIEVEP
DRDLEFYETQYALLQSRSLGQRVAKHLGLARRDEFFTAHGVTLDSEKFGASGRSNLTAKQVAAREKMASRLLLNNIEVEP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRRSRLVNLTYTSRSPGISAEVVNAWSTQFIAASMDRQLASTADARSFLEERLANLRARMEQSERDVVSYASRNDIVTLD
VRRSRLVNLTYTSRSPGISAEVVNAWSTQ                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSRGSDGKTQVQRTMVASDLEALNAALNMARADRIAAESRLSARGGDDNVEAITNPTIAQIRQKRADIASEYAKMIVRFE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNYPSAKALMMQIKSLDEAIARETARVGNSRSLSYQEAVKRENDLRDQVAALKGRLDKQQHDAIQYNIYQREADTNRQLY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DALLQRYKEIGIAGSVGVSNIVVVDQADVPSAPSAPSLPKNMALALVIGLGMAVVATLGLEQIDEGVSHPGQIQQLFHLP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGHVPLTDASVAEGIEDPKSYFSEAYFTIRSNLAFTTDHGLPRSFIVTSTQPAEGKSTTSYALARIIGRTGKSVLLVDG
                                                TSTQPAEGKSTTSYALARIIGRTGKSVLLVDG
                                                       GKS                 LLVDG
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMRSPDVHHLLGLDNAAGLSNALAGDDNVSALIRTTPYRGVSVLTSGPTPPSAAELLSSDRIRHIVNELQGLYDHVVIDA
DMRSPDVHHLLGLDNAAGLSNALAGDDNVSALIRTTPYRGVSVLTSGPTPPSAAELLSSDRIRHIVNELQGLYDHVVIDA
DMR                                                                        VVIDA
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPILGLSDAPLLGRAVEGAVLVIQAEGAAVRGIRAAISRLRMVNTHIFGTVLTKLKASELAYGYGYGYGYGYSYGDNAEN
PPILGLSDAPLLGRAVEGAVLVIQAEGAAVRGIRAAISRLRMVNTHIFGTVLTKLKASELAYGYGYGYGYGYSYGDNA  
PP                                                           YGYGYGYGYGYSY      
   
...
KAA


© 1998-2019