BYKdb

Annotate results for A0A0Q8RMY3

A0A0Q8RMY3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q8RMY3
DOMAINcd59/250TSATPAAGKSFLSMNLASSLARVIEEPVFLVDLDIRRASLAEEIGLVPERGIESFLEGDI
TDLTEIGHRIEGTNLGLFPAVRRTSNTAELLASDRFTQMIEVLRGRCEASTILFDLPPAF
ASDDAMISLSHLDGFILVVDAGKTTRRHVTDVLSMLSPTPCLGTILNRYSGGLGDSYGYG
YGGPDYGKYYNL
SITE-200/-202GKT
SITEWalker A'87/94FLVDLDIR
SITEWalker B170/176ILFDLPP
SITEY Cluster235/248YGYGYGGPDYGKYY
SITEWalker A66/68GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVILKLADLASFTPAISEIKKHRIVGFDSRDARARPFNLLRTSFAKKLKEDGHRLVGITSATPAAGKSFLSMNLASSLAR
                                                          TSATPAAGKSFLSMNLASSLAR
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIEEPVFLVDLDIRRASLAEEIGLVPERGIESFLEGDITDLTEIGHRIEGTNLGLFPAVRRTSNTAELLASDRFTQMIEV
VIEEPVFLVDLDIRRASLAEEIGLVPERGIESFLEGDITDLTEIGHRIEGTNLGLFPAVRRTSNTAELLASDRFTQMIEV
      FLVDLDIR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRGRCEASTILFDLPPAFASDDAMISLSHLDGFILVVDAGKTTRRHVTDVLSMLSPTPCLGTILNRYSGGLGDSYGYGYG
LRGRCEASTILFDLPPAFASDDAMISLSHLDGFILVVDAGKTTRRHVTDVLSMLSPTPCLGTILNRYSGGLGDSYGYGYG
         ILFDLPP                                                          YGYGYG
       250     
....:....|....:
GPDYGKYYNLKDPAA
GPDYGKYYNL     
GPDYGKYY       
© 1998-2019