BYKdb

Annotate results for A0A0Q8S1T2

A0A0Q8S1T2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8S1T2
DOMAINtad1/147MILCAAMAAAIVIAAAAYLVAEPRYLATAQVALERSAEQVIKVDSVIPTTDPDSAAVDTE
VQVLRSPELIGRVVDRLRLVRDPAFNSAAGDGQPTAQPDLIGRQRAIGTVLNGLTVKRDG
LSYAISVSFEGGTPVQSAQIANALVDD
DOMAINcd497/684TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFAEGVTLGLDEVLAGQAT
LEQAIVKDSMSGAFLLPQRTDSKGVGLTESPRLAELIEQVRERYDLVILDTPPVLPVDEA
RVIASMADGVVFLVRWRKTPTKAASVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGG
TFLKAYRP
SITEWalker A504/506GKT
SITEWalker A'524/531LLIDADAR
SITEWalker B603/609VILDTPP
SITEY Cluster682/686YRPYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MILCAAMAAAIVIAAAAYLVAEPRYLATAQVALERSAEQVIKVDSVIPTTDPDSAAVDTEVQVLRSPELIGRVVDRLRLV
MILCAAMAAAIVIAAAAYLVAEPRYLATAQVALERSAEQVIKVDSVIPTTDPDSAAVDTEVQVLRSPELIGRVVDRLRLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDPAFNSAAGDGQPTAQPDLIGRQRAIGTVLNGLTVKRDGLSYAISVSFEGGTPVQSAQIANALVDDYVSGQVGSKTEAT
RDPAFNSAAGDGQPTAQPDLIGRQRAIGTVLNGLTVKRDGLSYAISVSFEGGTPVQSAQIANALVDD             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRARGFLEERLQDLRAQVVGAEREVADYRAAHSLFAVSEASSVTQQELSGLSTQLAQAKAENAAAQARLSAARAQLSGGR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGEELGDSLDSPVVSQLRAQRAEVAREVGALEKRYGPRHPDLVRAQSQLRVADQQIAAEVQRIVANVSIQASIANQRAGS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAGSVAQSEGKLASDNAASVRLNELERNAESARTLYQAFLDRYRQTVAQSGLERSDAYIVSRARVPGAPSSPNMLIYAAM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVGGLGIGVLLVVLLQLLERGLETSDAIEDALGLSTLAAIPDANTLPGYRKLGPPAPPAELLLKRPQSTYAEAFRTLRT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIQFAEAANPIRVVAITSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFAEGVTLGLDEVLAGQATLEQA
                TSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFAEGVTLGLDEVLAGQATLEQA
                       GKT                 LLIDADAR                             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVKDSMSGAFLLPQRTDSKGVGLTESPRLAELIEQVRERYDLVILDTPPVLPVDEARVIASMADGVVFLVRWRKTPTKAA
IVKDSMSGAFLLPQRTDSKGVGLTESPRLAELIEQVRERYDLVILDTPPVLPVDEARVIASMADGVVFLVRWRKTPTKAA
                                          VILDTPP                               
       650       660       670       680        
....:....|....:....|....:....|....:....|....:...
SVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKAYRPYYAD
SVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKAYRP    
                                         YRPYY  
© 1998-2019