BYKdb

Annotate results for A0A0Q8S355

A0A0Q8S355 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8S355
DOMAINtad1/177MPPLLLAYWQIVLRWKWLIAAIIVASVIAGLILSLLMTPQYRATARMEVSREQKNVTNVQ
GLEGADAGQNLEFYNTQWALLEARSLAERVARELRLADKPEFFIAHGETPEGDDETAGAG
SPMRSTTLRHKREAQAVDLLLDHIAISPIRGSALVDVGYVSASPHLSAQVANSWTQQ
DOMAINcd516/705TSTRPAEGKSTTSFALATILARSGRRVLLIDADMRSPSLAGFVGLSNEHGLSNYLAGEDG
WQKLVHDNGAGIPAYMVAGPTPPSAAELLSSDRLSNLIGTLGQHFDHIVIDSPPILGLAD
APLLSRAVEGVVFVVEADGVPVRGIRSALARLRAAQSRIFGVVLTKLHQRHAGYGYGYGY
GFNYGQDEDE
SITEWalker A523/525GKS
SITEWalker A'543/550LLIDADMR
SITEWalker B623/629IVIDSPP
SITEY Cluster689/699YGYGYGYGFNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPPLLLAYWQIVLRWKWLIAAIIVASVIAGLILSLLMTPQYRATARMEVSREQKNVTNVQGLEGADAGQNLEFYNTQWAL
MPPLLLAYWQIVLRWKWLIAAIIVASVIAGLILSLLMTPQYRATARMEVSREQKNVTNVQGLEGADAGQNLEFYNTQWAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEARSLAERVARELRLADKPEFFIAHGETPEGDDETAGAGSPMRSTTLRHKREAQAVDLLLDHIAISPIRGSALVDVGYV
LEARSLAERVARELRLADKPEFFIAHGETPEGDDETAGAGSPMRSTTLRHKREAQAVDLLLDHIAISPIRGSALVDVGYV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SASPHLSAQVANSWTQQFILQSMDRRFSSTSDARTFLEGRLGELRARLENSEREAVNFAADKGIVQISRSSDNGASGGDV
SASPHLSAQVANSWTQQ                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLASMDLTLLNTELVKATAQRVAAESRLNSGGRTATAESLGSQALASMRTKRAEAAADYAKILVQFDPEYPAAVALKRQM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DALDQSISREETRISGTRTGEYREAVQRENKLRERVESLKGRLADQERNGIQYQIYMREADTNRQLYEALLQRYKEIGVA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVSANNIAIIDTAKPSTIPSSPNLPLNLALALIAGIGLAGLATLVLNQIDEGLRNPADVNRALQLPLLGSVPDVEDGSAI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLLRDPKTALSEAYFSIQSNIAFSTDHGVPRSLMVTSTRPAEGKSTTSFALATILARSGRRVLLIDADMRSPSLAGFVGL
                                   TSTRPAEGKSTTSFALATILARSGRRVLLIDADMRSPSLAGFVGL
                                          GKS                 LLIDADMR          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNEHGLSNYLAGEDGWQKLVHDNGAGIPAYMVAGPTPPSAAELLSSDRLSNLIGTLGQHFDHIVIDSPPILGLADAPLLS
SNEHGLSNYLAGEDGWQKLVHDNGAGIPAYMVAGPTPPSAAELLSSDRLSNLIGTLGQHFDHIVIDSPPILGLADAPLLS
                                                              IVIDSPP           
       650       660       670       680       690       700         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
RAVEGVVFVVEADGVPVRGIRSALARLRAAQSRIFGVVLTKLHQRHAGYGYGYGYGFNYGQDEDEAKPA
RAVEGVVFVVEADGVPVRGIRSALARLRAAQSRIFGVVLTKLHQRHAGYGYGYGYGFNYGQDEDE    
                                                YGYGYGYGFNY          

© 1998-2019