BYKdb

Annotate results for A0A0Q8V9V9

A0A0Q8V9V9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8V9V9
DOMAINtad1/127MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYESDSTVFLSVDVRDTTDAYATLLFASNR
AESYAKVIKSTELAAEVIDELNLKITPEDLSSRTNAEVVESTSLIKISVKDENARDAQQI
ADVMTDR
DOMAINcd259/447TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTE
IHDAIQVHEPSGLHVLASGAKPPNPTEILQSRITQDLVERLRASYDIVIIDAPPLLPVAD
ASVLAKLADGVIIVVRHAKTTRDQVTEAVNRLNQVGARLYGVVVNMVARRAVGSYYYYYY
EETAPSGRG
SITE-315/-317GKT
SITEWalker A'286/293LIIDADLR
SITEWalker B366/372VIIDAPP
SITEY Cluster433/438YYYYYY
SITEWalker A266/268GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYESDSTVFLSVDVRDTTDAYATLLFASNRAESYAKVIKSTELAAEVIDE
MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYESDSTVFLSVDVRDTTDAYATLLFASNRAESYAKVIKSTELAAEVIDE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNLKITPEDLSSRTNAEVVESTSLIKISVKDENARDAQQIADVMTDRFTKYIGKIEAPGGEGSSPIVARVTDKASYNPSQ
LNLKITPEDLSSRTNAEVVESTSLIKISVKDENARDAQQIADVMTDR                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPNILLNMIVAFLLGILLGVALALAREILDRTIRTADHVADITPAPVLASIGFDGDIKSAPLLTDLGGFAARTEAFRLL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTNLQFIDLDHRPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
                  TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
                         GKT                 LIIDADLR                           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAIQVHEPSGLHVLASGAKPPNPTEILQSRITQDLVERLRASYDIVIIDAPPLLPVADASVLAKLADGVIIVVRHAKTTR
DAIQVHEPSGLHVLASGAKPPNPTEILQSRITQDLVERLRASYDIVIIDAPPLLPVADASVLAKLADGVIIVVRHAKTTR
                                             VIIDAPP                            
       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
DQVTEAVNRLNQVGARLYGVVVNMVARRAVGSYYYYYYEETAPSGRGSNSSSGGRRRA
DQVTEAVNRLNQVGARLYGVVVNMVARRAVGSYYYYYYEETAPSGRG           
                                YYYYYY                    
© 1998-2019