BYKdb

Annotate results for A0A0Q8W6H9

A0A0Q8W6H9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8W6H9
DOMAINtad1/134MDLRQFLGILRGRWKFIISTLVIGTIATVGLVLNLSPVYSSSARVFVSTPTNGQADPYAA
TVFAAQRIASYADLATDPTVLQKVIDRLGLKVTREELAGDISATVVPQTLILQITAKASS
PQLAQDIAGAESDE
DOMAINcd265/450SSALPDEGKTLVATNLAVSMAKSGRSVLLIDADMRNPNVADLLGLENSVGVITVLIGRST
LEHAIQEHSTGVHFLGTGPRPPNPAEVLDTQAMRDLLAHARSQYDVVIIDAPPLLPVADT
AILMTEVDGALLLARYGSTGREQLRLAVSRIEAVGGRLFGTVLNRTPRRASTDGYGYYGY
GYGVPY
SITEWalker A272/274GKT
SITEWalker A'292/299LLIDADMR
SITEWalker B371/377VIIDAPP
SITEY Cluster439/450YGYYGYGYGVPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLRQFLGILRGRWKFIISTLVIGTIATVGLVLNLSPVYSSSARVFVSTPTNGQADPYAATVFAAQRIASYADLATDPTV
MDLRQFLGILRGRWKFIISTLVIGTIATVGLVLNLSPVYSSSARVFVSTPTNGQADPYAATVFAAQRIASYADLATDPTV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQKVIDRLGLKVTREELAGDISATVVPQTLILQITAKASSPQLAQDIAGAESDEIVDLVKEIEKPADSNLSAAIVARVTG
LQKVIDRLGLKVTREELAGDISATVVPQTLILQITAKASSPQLAQDIAGAESDE                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KASFNASPVAPSVLLDIIVGVLLSTFIGVAGAVLRDLLDTTVKTRQDVEFATGNAVMATLPFDPTVKKDPLSRDDTGSLS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAFKVLRTNLQFANLDASRQMIVVSSALPDEGKTLVATNLAVSMAKSGRSVLLIDADMRNPNVADLLGLENSVGVITVLI
                        SSALPDEGKTLVATNLAVSMAKSGRSVLLIDADMRNPNVADLLGLENSVGVITVLI
                               GKT                 LLIDADMR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRSTLEHAIQEHSTGVHFLGTGPRPPNPAEVLDTQAMRDLLAHARSQYDVVIIDAPPLLPVADTAILMTEVDGALLLARY
GRSTLEHAIQEHSTGVHFLGTGPRPPNPAEVLDTQAMRDLLAHARSQYDVVIIDAPPLLPVADTAILMTEVDGALLLARY
                                                  VIIDAPP                       
       410       420       430       440       450       460       470       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
GSTGREQLRLAVSRIEAVGGRLFGTVLNRTPRRASTDGYGYYGYGYGVPYEIDKGKVKVKFKDSETALSGTGRRAKR
GSTGREQLRLAVSRIEAVGGRLFGTVLNRTPRRASTDGYGYYGYGYGVPY                           
                                      YGYYGYGYGVPY                           
© 1998-2019