BYKdb

Annotate results for A0A0Q8XKK5

A0A0Q8XKK5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q8XKK5
DOMAINcd393/582TSTSPAEGKSTTSFAMAVVLGRTGKNVLILDADMRSPSIHQFLDADNAAGLSNILAGDND
WQKLIKPSSFKGLSLLSAGPTPPSAAELLSSDRMSMLIEQLLEHFDHVVVDAPPILGLAD
APLLSKAVEGCIYVIETERVAVRGVRAALDRLHSVHAHIFGGVLTKLSSRHAGYGYGYGY
GYGYGDTADT
SITEWalker A400/402GKS
SITEWalker A'420/427LILDADMR
SITEWalker B500/506VVVDAPP
SITEY Cluster566/576YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTAVERAKREKAAVQILQSNIAISPIRNSALVDIKYTSGSPELAAQIANTWAQQFIEASMDRRFASTADARKFLESRLAD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRTRLETSERDLVNYAAEKGITALGTSKSADGRTEVERTLVSSDLEALNAALASATADRLAAESRSVRQRGASPQALTNP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISSLRQRRAEVASELAKLSVQFEPGYPASRALAEQLQSLDSAISREEARVDSSRSTEYREAQMREEGLRRQVETLRLQL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKQSRDSIQYNIYQREADTNRQLYDGLLQRYKEIGVAGVGANNIALVDVAKVPDRQSSPRLMFNMALALVAGFALAGLAT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FALEQIDEGFREPGEVSKQLQIPLLGSVPNIEEGDALQQLMDAKSSVSEAYLSIRSNLAFSTDHGVPRAFMVTSTSPAEG
                                                                        TSTSPAEG
                                                                               G
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTTSFAMAVVLGRTGKNVLILDADMRSPSIHQFLDADNAAGLSNILAGDNDWQKLIKPSSFKGLSLLSAGPTPPSAAEL
KSTTSFAMAVVLGRTGKNVLILDADMRSPSIHQFLDADNAAGLSNILAGDNDWQKLIKPSSFKGLSLLSAGPTPPSAAEL
KS                 LILDADMR                                                     
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSDRMSMLIEQLLEHFDHVVVDAPPILGLADAPLLSKAVEGCIYVIETERVAVRGVRAALDRLHSVHAHIFGGVLTKLS
LSSDRMSMLIEQLLEHFDHVVVDAPPILGLADAPLLSKAVEGCIYVIETERVAVRGVRAALDRLHSVHAHIFGGVLTKLS
                   VVVDAPP                                                      
       570       580       
....:....|....:....|....:..
SRHAGYGYGYGYGYGYGDTADTNARDG
SRHAGYGYGYGYGYGYGDTADT     
     YGYGYGYGYGY           
© 1998-2019