BYKdb

Annotate results for A0A0Q8Y2V9

A0A0Q8Y2V9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q8Y2V9
DOMAINtad1/134MTFREFLGVLGARWRIIAVSLLAVVAATAVQTMLTPAVYTSSSKIYLRATTPASATNNNQ
VATYAVSAGDLGTYLEVLTSPSVMDPLRTRLGLPAGFPLSVSGDVSQTSNMMTITATGGD
PQLVARVATEAGPV
DOMAINcd266/453TSSVPGEGKTTTTINLALAMADAGSKVLLIDGDLRNPSVASTMGLDGSFGLTTLLLGQAD
TDDVIQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVID
AVLINKLTHGLIMVVGAERTKKRDLASAVQSLETVDAPVAGFALNMVSAGSSTAHRYGYY
GYNRDADV
SITEWalker A273/275GKT
SITEWalker A'293/300LLIDGDLR
SITEWalker B373/379ILVDSPP
SITEY Cluster442/447YGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTFREFLGVLGARWRIIAVSLLAVVAATAVQTMLTPAVYTSSSKIYLRATTPASATNNNQVATYAVSAGDLGTYLEVLTS
MTFREFLGVLGARWRIIAVSLLAVVAATAVQTMLTPAVYTSSSKIYLRATTPASATNNNQVATYAVSAGDLGTYLEVLTS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSVMDPLRTRLGLPAGFPLSVSGDVSQTSNMMTITATGGDPQLVARVATEAGPVLADVAKKFSPLLASNGQAVEADTIVP
PSVMDPLRTRLGLPAGFPLSVSGDVSQTSNMMTITATGGDPQLVARVATEAGPV                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASVPADPTSPNAKRNLMLGALLGLALGVGLALLRHTLDTKVRTEEDIKALSKRPILGDIPMVKSVKNGLLSLESDPHGRH


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AESIRRLRTNILFVDVTTGGHSFVVTSSVPGEGKTTTTINLALAMADAGSKVLLIDGDLRNPSVASTMGLDGSFGLTTLL
                         TSSVPGEGKTTTTINLALAMADAGSKVLLIDGDLRNPSVASTMGLDGSFGLTTLL
                                GKT                 LLIDGDLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGQADTDDVIQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMVV
LGQADTDDVIQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMVV
                                                    ILVDSPP                     
       410       420       430       440       450       460        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
GAERTKKRDLASAVQSLETVDAPVAGFALNMVSAGSSTAHRYGYYGYNRDADVKPSRRAKRSQAKHHS
GAERTKKRDLASAVQSLETVDAPVAGFALNMVSAGSSTAHRYGYYGYNRDADV               
                                         YGYYGY                     
© 1998-2019