BYKdb

Annotate results for A0A0Q9F442

A0A0Q9F442 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9F442
DOMAINtad23/282DDIDLPNLVSTLADHKWTIAFGTLLFFLLSAAYAMLATPKYEANAVVQVESRPPTVPGLS
TSSATPMPPVVDAPAATESQLLTSRRVLGEAMSELDLDVSAKPMRLPVIGDLIARAQQRF
NPGVLAAPWLDLKQYGWGGERIDVAHLKLPDALMDVPLRLQAGEHGRYVLFGPDGQQLLE
GTVGRTASNGQGVSLDLKTLVAQPGTRFELRKFNPVAVISALKNDITVAEQGRSSGVIAL
TYAHEDPIRAREVLDKITQA
DOMAINcd561/749AAPSPGVGKTFVCANLAVTMAQAGQSVLLIDADMRRGTLHQAVGVRSEGGLSELISGQIT
PEDAVRKVPGTERMSFISRGAVPPNPSELLMRPRFAELLKQMARDFDVVVIDTPPVLAVT
DAAVIGHHVGTCLMVVRWGLNQQREIALAKQRLEQNGVDVRGAIFNAVEKRGSGQYAYSY
YDYRALHEA
SITEWalker A568/570GKT
SITEWalker A'588/595LLIDADMR
SITEWalker B669/675VVIDTPP
SITEY Cluster736/743YAYSYYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATQLIPRTEPIQAIPAVATREDDIDLPNLVSTLADHKWTIAFGTLLFFLLSAAYAMLATPKYEANAVVQVESRPPTVPG
                      DDIDLPNLVSTLADHKWTIAFGTLLFFLLSAAYAMLATPKYEANAVVQVESRPPTVPG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSTSSATPMPPVVDAPAATESQLLTSRRVLGEAMSELDLDVSAKPMRLPVIGDLIARAQQRFNPGVLAAPWLDLKQYGWG
LSTSSATPMPPVVDAPAATESQLLTSRRVLGEAMSELDLDVSAKPMRLPVIGDLIARAQQRFNPGVLAAPWLDLKQYGWG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GERIDVAHLKLPDALMDVPLRLQAGEHGRYVLFGPDGQQLLEGTVGRTASNGQGVSLDLKTLVAQPGTRFELRKFNPVAV
GERIDVAHLKLPDALMDVPLRLQAGEHGRYVLFGPDGQQLLEGTVGRTASNGQGVSLDLKTLVAQPGTRFELRKFNPVAV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISALKNDITVAEQGRSSGVIALTYAHEDPIRAREVLDKITQAYVRQNVARNSAEAAKRLQFVSKQLPNVRRELANAQAAL
ISALKNDITVAEQGRSSGVIALTYAHEDPIRAREVLDKITQA                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAFQTRTHTLDVGMQNQALLNQTVALDTNIRQLQVQLADAGSRYTPSHPVYASLAQQIARFEGEKGRLQGQISQLPDTQQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLFRLNRDVEVINQTYANLLDQEQQLNIARASAVGNARIIDPADVNLDSPAWPKPMLILAVGTALGSVLMVALVLLRQTF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRGVEDPIDIELLGLPVYASIPFSARGRQIATQPGRRRRDGRQRLLALRSPSDLAMEALRTLRTSLHFARMEMKNNVLMI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAPSPGVGKTFVCANLAVTMAQAGQSVLLIDADMRRGTLHQAVGVRSEGGLSELISGQITPEDAVRKVPGTERMSFISRG
AAPSPGVGKTFVCANLAVTMAQAGQSVLLIDADMRRGTLHQAVGVRSEGGLSELISGQITPEDAVRKVPGTERMSFISRG
       GKT                 LLIDADMR                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVPPNPSELLMRPRFAELLKQMARDFDVVVIDTPPVLAVTDAAVIGHHVGTCLMVVRWGLNQQREIALAKQRLEQNGVDV
AVPPNPSELLMRPRFAELLKQMARDFDVVVIDTPPVLAVTDAAVIGHHVGTCLMVVRWGLNQQREIALAKQRLEQNGVDV
                            VVIDTPP                                             
       730       740       750   
....:....|....:....|....:....|...
RGAIFNAVEKRGSGQYAYSYYDYRALHEAPARR
RGAIFNAVEKRGSGQYAYSYYDYRALHEA    
               YAYSYYDY          

© 1998-2019