BYKdb

Annotate results for A0A0Q9K1Q8

A0A0Q9K1Q8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9K1Q8
DOMAINtad1/135MTLQDLWKITRRQFVAIATCALLGVLLAFGWMLMQPKVYTASAGGYVTAGGGTSIGESFS
SQTLAQQKAQAYVTLFTNRRVAEAVIEDLGLDSTPQDLVSRISAAVPDQGVTITVTATGP
TPEEARDVADAVVTA
DOMAINcd281/467TSANQGEGKSTVAANLATVLAESGEQVVLVDADLRRSAVARAFDMDGDVGLSEVLAGAIP
LSDALQETRTPGLQILAAGATPPNPSELLGSHRMEALIEQLSREHFVVLDAPPILPVTDA
VLLTRSADGAVLVAAAGRTHKEALERAAGSLRAVDAKVLGAVLNGASTSRVDRVRYGDVE
YGYVKSY
SITEWalker A288/290GKS
SITEWalker A'308/315VLVDADLR
SITEWalker B387/393VVLDAPP
SITEY Cluster456/473YGDVEYGYVKSYSDDYVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLQDLWKITRRQFVAIATCALLGVLLAFGWMLMQPKVYTASAGGYVTAGGGTSIGESFSSQTLAQQKAQAYVTLFTNRR
MTLQDLWKITRRQFVAIATCALLGVLLAFGWMLMQPKVYTASAGGYVTAGGGTSIGESFSSQTLAQQKAQAYVTLFTNRR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAEAVIEDLGLDSTPQDLVSRISAAVPDQGVTITVTATGPTPEEARDVADAVVTAAAKEAKRIEESGPTRQVVGADGKTR
VAEAVIEDLGLDSTPQDLVSRISAAVPDQGVTITVTATGPTPEEARDVADAVVTA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVKSTAQVLIEPNESAVLPKSPTSPNPTRILPLGLLLGLLAGYGVAALRHHNDTKLRHVDEVEATAGAGVLGVLPQSAAL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSERGQAYHPKAFHEGEALRKLRTNLRFVDVDNQPRSIVVTSANQGEGKSTVAANLATVLAESGEQVVLVDADLRRSAVA
                                        TSANQGEGKSTVAANLATVLAESGEQVVLVDADLRRSAVA
                                               GKS                 VLVDADLR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAFDMDGDVGLSEVLAGAIPLSDALQETRTPGLQILAAGATPPNPSELLGSHRMEALIEQLSREHFVVLDAPPILPVTDA
RAFDMDGDVGLSEVLAGAIPLSDALQETRTPGLQILAAGATPPNPSELLGSHRMEALIEQLSREHFVVLDAPPILPVTDA
                                                                  VVLDAPP       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLTRSADGAVLVAAAGRTHKEALERAAGSLRAVDAKVLGAVLNGASTSRVDRVRYGDVEYGYVKSYSDDYVYESEDAAA
VLLTRSADGAVLVAAAGRTHKEALERAAGSLRAVDAKVLGAVLNGASTSRVDRVRYGDVEYGYVKSY             
                                                       YGDVEYGYVKSYSDDYVY       
       490      
....:....|....:.
TSRQDVKAKRRRRVRG


© 1998-2019