BYKdb

Annotate results for A0A0Q9L0H3

A0A0Q9L0H3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q9L0H3
DOMAINcd288/477TSAHAAEGKTTSVANLAASFAETGQTVLVLDADLRSPDIHTAFDVPQGAGISDYLSDPSD
GAALDAVVRPTSVPNVRIITAGTSLAHPAALASRMGQMLEQARDLADVILIDSAPLLEAS
DVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQTMRADAYGYGY
GENRQSKKKA
SITEWalker A295/297GKT
SITEWalker A'315/322LVLDADLR
SITEWalker B396/402ILIDSAP
SITEY Cluster463/467YGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYTATATLLVGSNDPETGSTNLGRIALYMTSGEVPKR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAARVDFTGDPALLASGLTVTPDTVAQALTVSATASDGKQAAAVANAFATETVKFIEERKRPGAETTTLSLLQPATPIPS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AATDGGFVIPPGRGPRTAIATLLGLLVGLGLALLLDRLDSRLRTRGEIASALRMPIIAEIPRLKRSQRNSASIAVASDPL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNYSDGYRAARTALVHTSGQIMPGDYTPRRPGGEESRSRQGGRLVLITSAHAAEGKTTSVANLAASFAETGQTVLVLDAD
                                               TSAHAAEGKTTSVANLAASFAETGQTVLVLDAD
                                                      GKT                 LVLDAD
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRSPDIHTAFDVPQGAGISDYLSDPSDGAALDAVVRPTSVPNVRIITAGTSLAHPAALASRMGQMLEQARDLADVILIDS
LRSPDIHTAFDVPQGAGISDYLSDPSDGAALDAVVRPTSVPNVRIITAGTSLAHPAALASRMGQMLEQARDLADVILIDS
LR                                                                         ILIDS
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQTMRADAYGYGYGENRQSKKKARRG
APLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQTMRADAYGYGYGENRQSKKKA   
AP                                                            YGYGY             
       490       500       510         
....:....|....:....|....:....|....:....
RKRQQLRAAEPVADELHPPTTGDERPRESRHDRRTSSSL


© 1998-2019