BYKdb

Annotate results for A0A0Q9LZR0

A0A0Q9LZR0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q9LZR0
DOMAINcd276/462TSPLPGDGKSTVAMNLAAALSMSDRRVVLIDGDLRRPVVAESFGLIEGLGLTDVLIGSVE
FEEVVQQVGGLPNLSVLAAGRVPPNPSEMLGSKAMRRLLEGLGETYTVIVDAPPLLPVTD
AAVLTASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSPKSSSAGYYSGN
YGPLQET
SITEWalker A283/285GKS
SITEWalker A'303/310VLIDGDLR
SITEWalker B383/389VIVDAPP
SITEY Cluster451/456YYSGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELTDYLRVARTYWRGLVAFMLLGVAVAGGLSLVTPKVYQADASGFVSAGASSNPGEASVGDSLAKSRATSYVDLAKSRA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAQDVINTLGLGAQPAGLIGSITVTQPVDTVLLKISARAATPRGAQQLADAWVAALARQVQAVENPTGKAAQALRVVPIE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAALPASPVSPNTRRNLALGFVLGLMLGLGYALLRSQLDRRVREPEVVERDFGVTVAGAIPETSALVRKKGGLVPLVVAG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSKEKDPVHSAESFLKLRTNLQFMDIDNPPRIIVITSPLPGDGKSTVAMNLAAALSMSDRRVVLIDGDLRRPVVAESFGL
                                   TSPLPGDGKSTVAMNLAAALSMSDRRVVLIDGDLRRPVVAESFGL
                                          GKS                 VLIDGDLR          
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEGLGLTDVLIGSVEFEEVVQQVGGLPNLSVLAAGRVPPNPSEMLGSKAMRRLLEGLGETYTVIVDAPPLLPVTDAAVLT
IEGLGLTDVLIGSVEFEEVVQQVGGLPNLSVLAAGRVPPNPSEMLGSKAMRRLLEGLGETYTVIVDAPPLLPVTDAAVLT
                                                              VIVDAPP           
       410       420       430       440       450       460       470       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
ASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSPKSSSAGYYSGNYGPLQETPQRAVRSEAGTAATR
ASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSPKSSSAGYYSGNYGPLQET               
                                                  YYSGNY                     
© 1998-2019