BYKdb

Annotate results for A0A0Q9MJT3

A0A0Q9MJT3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9MJT3
DOMAINtad12/148PGLDLADYLNVLRVYWKAIVAFTLLTTLGAAGWTALQPKIYSSDSSGIVVTPGSNNVSLA
LAGDSLAKAKVKNYESVAKSRLVADRVIQALDLKTTADALLGSISVKVPLDTAEIRVTAQ
SKDPATAQRVADAWVNG
DOMAINcd295/481TSSVQAEGKSTVTANLAVAMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAE
LADVLQPWAALPNLSVLGSGRIPPNPSELLGSNAMKNMLELLAEEAIVLIDAPPLLPVTD
AAVLTRAADGAIVVVGAGRTTEDQLSQSLGNLEKVKGRILGAVLNYVPTRGADAYSYYGT
YTTSSGR
SITEWalker A302/304GKS
SITEWalker A'322/329VVVDGDLR
SITEWalker B402/408VLIDAPP
SITEY Cluster469/475YSYYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTTAVPAETSPGLDLADYLNVLRVYWKAIVAFTLLTTLGAAGWTALQPKIYSSDSSGIVVTPGSNNVSLALAGDSLAKA
           PGLDLADYLNVLRVYWKAIVAFTLLTTLGAAGWTALQPKIYSSDSSGIVVTPGSNNVSLALAGDSLAKA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVKNYESVAKSRLVADRVIQALDLKTTADALLGSISVKVPLDTAEIRVTAQSKDPATAQRVADAWVNGLAAQVEAIETAP
KVKNYESVAKSRLVADRVIQALDLKTTADALLGSISVKVPLDTAEIRVTAQSKDPATAQRVADAWVNG            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SADAAGSSPSAETAVRVLPLGKAVLPTSPTSPNTKLNLALGALVGLALGVAYSLVRRHLDRRIRKAADIERMFGVPVIGT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPVDHRLDGKSTIVDAGTAAQLHDAGGAMAEALRELRTNLSFLDVDRPPRIMVVTSSVQAEGKSTVTANLAVAMAAAGEN
                                                      TSSVQAEGKSTVTANLAVAMAAAGEN
                                                             GKS                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWAALPNLSVLGSGRIPPNPSELLGSNAMKNMLELLAEEA
VVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWAALPNLSVLGSGRIPPNPSELLGSNAMKNMLELLAEEA
 VVVDGDLR                                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVLIDAPPLLPVTDAAVLTRAADGAIVVVGAGRTTEDQLSQSLGNLEKVKGRILGAVLNYVPTRGADAYSYYGTYTTSSG
IVLIDAPPLLPVTDAAVLTRAADGAIVVVGAGRTTEDQLSQSLGNLEKVKGRILGAVLNYVPTRGADAYSYYGTYTTSSG
 VLIDAPP                                                            YSYYGTY     
       490     
....:....|....:
RAITADLGANYVDHL
R              

© 1998-2019