BYKdb

Annotate results for A0A0Q9PJL3

A0A0Q9PJL3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9PJL3
DOMAINtad12/268DEIDLGELLGTLIDHKWLIIIVTGVFFVVAVAYALLATPIYQANAIVQVEQKVPNLPGLS
ALSQTLGASSSEATTEIALITSRTVIGKAVDELNLDIEVEPRRFPLIGNFVARRYSPAKP
GEVARAWLGMNGYDWGGSMLDIFELKVPTSLEEKKLTLVAGEQGGYTLLDDDGHALLTGR
QGQAASGRGVSIQVKTLLANPGTRFSVIHHRSLSTISQLQQDINASEQGKDSGIIALTYQ
NADPDLAAALLDQVSQA
DOMAINcd547/735SGSSPEAGKTFISSNLAAVIAQGGQRVLLIDGDMRKGALHKVIGGSAEGGLSDLISGQMT
REQVTRTVNGVESLHFIARGKVPPNPSELLMNAKFTALLEQLKPLYDLVLIDTPPILAVT
DAAVIGHQAGTSLLVVRFGLNQAREIALAKQRFEQNGVEIKGAIFNAVEKRSAGYYSYGY
YEYKTAKTS
SITEWalker A554/556GKT
SITEWalker A'574/581LLIDGDMR
SITEWalker B655/661VLIDTPP
SITEY Cluster721/729YYSYGYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAATQNPSQRDDEIDLGELLGTLIDHKWLIIIVTGVFFVVAVAYALLATPIYQANAIVQVEQKVPNLPGLSALSQTLGAS
           DEIDLGELLGTLIDHKWLIIIVTGVFFVVAVAYALLATPIYQANAIVQVEQKVPNLPGLSALSQTLGAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSEATTEIALITSRTVIGKAVDELNLDIEVEPRRFPLIGNFVARRYSPAKPGEVARAWLGMNGYDWGGSMLDIFELKVPT
SSEATTEIALITSRTVIGKAVDELNLDIEVEPRRFPLIGNFVARRYSPAKPGEVARAWLGMNGYDWGGSMLDIFELKVPT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLEEKKLTLVAGEQGGYTLLDDDGHALLTGRQGQAASGRGVSIQVKTLLANPGTRFSVIHHRSLSTISQLQQDINASEQG
SLEEKKLTLVAGEQGGYTLLDDDGHALLTGRQGQAASGRGVSIQVKTLLANPGTRFSVIHHRSLSTISQLQQDINASEQG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KDSGIIALTYQNADPDLAAALLDQVSQAYVRQNVDRNSAEAANSLKFVKEQLPKVRQDLEAAQSALNNFQTQAHSVDITL
KDSGIIALTYQNADPDLAAALLDQVSQA                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTKGLLDQEVAVETSIQQLRMQQADMERRYTHEHPAYKALMQQIGQLESQKAAMEKQVGSLPDTQQQLLRLTRDVQVSNE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYTGLLNQAQQLDIARAGTVGNVRIIDKAAVDTTRPVKPKKAIVVLGSTVLGAFLAAAFVFIRQMLNRGVEDPAAIEQLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPVYASIPVSATEMESSVRGKHVRGDGKQHLLVVSDPADLATEALRSLRTSLHFARLEAKNNVLMISGSSPEAGKTFISS
                                                                  SGSSPEAGKTFISS
                                                                         GKT    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAAVIAQGGQRVLLIDGDMRKGALHKVIGGSAEGGLSDLISGQMTREQVTRTVNGVESLHFIARGKVPPNPSELLMNAK
NLAAVIAQGGQRVLLIDGDMRKGALHKVIGGSAEGGLSDLISGQMTREQVTRTVNGVESLHFIARGKVPPNPSELLMNAK
             LLIDGDMR                                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FTALLEQLKPLYDLVLIDTPPILAVTDAAVIGHQAGTSLLVVRFGLNQAREIALAKQRFEQNGVEIKGAIFNAVEKRSAG
FTALLEQLKPLYDLVLIDTPPILAVTDAAVIGHQAGTSLLVVRFGLNQAREIALAKQRFEQNGVEIKGAIFNAVEKRSAG
              VLIDTPP                                                           
       730     
....:....|....:
YYSYGYYEYKTAKTS
YYSYGYYEYKTAKTS
YYSYGYYEY      

© 1998-2019