BYKdb

Annotate results for A0A0Q9SBW5

A0A0Q9SBW5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9SBW5
DOMAINtad1/128MRTARRRWKTIVALLLIALVAAGAYSFLVTPKYESHARVFISTDVEDSSEAIAASLVSSG
RVSSYADLATSREIMEKVIAELNLEESPSELADMIKAEVEPLTVIIDINVTHPDPKIAQA
IAQTEAEQ
DOMAINcd259/447TSALPGEGKTTTSTNLAIALAQAGRRVLLVDGDLRRPRVAGLLGLESKVGLTTVLVGKSS
LVDSIQQHGDTGVDFLGGGPIPPNPTEVLQSNATRDLIHKMRDMYDVVIIDAPPLLPVAD
AAILARAADGALMVTRHGKTTKEQLHDACQRIDQVDARLYGVVVNMAPRRGQQDYYYYYA
DESDPAIKS
SITE-315/-317GKS
SITEWalker A'286/293LLVDGDLR
SITEWalker B366/372VIIDAPP
SITEY Cluster433/437YYYYY
SITE-396/-398GKT
SITEWalker A266/268GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTARRRWKTIVALLLIALVAAGAYSFLVTPKYESHARVFISTDVEDSSEAIAASLVSSGRVSSYADLATSREIMEKVIA
MRTARRRWKTIVALLLIALVAAGAYSFLVTPKYESHARVFISTDVEDSSEAIAASLVSSGRVSSYADLATSREIMEKVIA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELNLEESPSELADMIKAEVEPLTVIIDINVTHPDPKIAQAIAQTEAEQLTKYITRIDAPNRAATPIRATVADPASYSSDP
ELNLEESPSELADMIKAEVEPLTVIIDINVTHPDPKIAQAIAQTEAEQ                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPRTLLNLVVAGLIGLVIGCGVAVLREITDNTVKTADDIRKITHTGVVANIGYDSDVPSHPLLTDLNGFAPRAEAFRVL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAIALAQAGRRVLLVDGDLRRPRVAGLLGLESKVGLTTVLVGKSSLV
                  TSALPGEGKTTTSTNLAIALAQAGRRVLLVDGDLRRPRVAGLLGLESKVGLTTVLVGKSSLV
                         GKT                 LLVDGDLR                           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSIQQHGDTGVDFLGGGPIPPNPTEVLQSNATRDLIHKMRDMYDVVIIDAPPLLPVADAAILARAADGALMVTRHGKTTK
DSIQQHGDTGVDFLGGGPIPPNPTEVLQSNATRDLIHKMRDMYDVVIIDAPPLLPVADAAILARAADGALMVTRHGKTTK
                                             VIIDAPP                            
       410       420       430       440       450     
....:....|....:....|....:....|....:....|....:....|....:
EQLHDACQRIDQVDARLYGVVVNMAPRRGQQDYYYYYADESDPAIKSGRWVSLKP
EQLHDACQRIDQVDARLYGVVVNMAPRRGQQDYYYYYADESDPAIKS        
                                YYYYY                  
© 1998-2019