BYKdb

Annotate results for A0A0Q9T8B9

A0A0Q9T8B9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q9T8B9
DOMAINcd46/229TSAQPAEGKSTTVANLAVAYAQEGKKVLVIDADLRKPTMHHYFGKSNRKGLTNTLASQND
VDDVMFDTTVDNLFLIPSGPIPPNPSELLTSQKMTAFLEDMAARFDVIVVDSPPTLAVTD
SQILAAKCDGVVLVINEGKVKRDVAKKAIDNLKRVQAKILGVVLNNKRHSKGDSTYYYYY
GHKE
SITE-89/-91GKS
SITEWalker A'73/80LVIDADLR
SITEWalker B153/159IVVDSPP
SITEY Cluster221/225YYYYY
SITEWalker A53/55GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPVPTNKHQLITEINPRSHISEAYRTLRTNIQFSSIDQVIKTILVTSAQPAEGKSTTVANLAVAYAQEGKKVLVIDADLR
                                             TSAQPAEGKSTTVANLAVAYAQEGKKVLVIDADLR
                                                    GKS                 LVIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTMHHYFGKSNRKGLTNTLASQNDVDDVMFDTTVDNLFLIPSGPIPPNPSELLTSQKMTAFLEDMAARFDVIVVDSPPT
KPTMHHYFGKSNRKGLTNTLASQNDVDDVMFDTTVDNLFLIPSGPIPPNPSELLTSQKMTAFLEDMAARFDVIVVDSPPT
                                                                        IVVDSPP 
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LAVTDSQILAAKCDGVVLVINEGKVKRDVAKKAIDNLKRVQAKILGVVLNNKRHSKGDSTYYYYYGHKE
LAVTDSQILAAKCDGVVLVINEGKVKRDVAKKAIDNLKRVQAKILGVVLNNKRHSKGDSTYYYYYGHKE
                                                            YYYYY    
© 1998-2019