BYKdb

Annotate results for A0A0Q9TBP0

A0A0Q9TBP0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9TBP0
DOMAINtad1/117MALLVLLAAVAVSCAYSLAATPLYIATADVLIEPSGADISASSGTKIDADEVATQVQVVT
SLPVSRLVQERFSLASPPDLSELVSVQAVGTSRILRVTAQDSSPDRAARTANIVATS
DOMAINcd311/499TSGQESEGKTVTSCNLAVSAARLGLNVVLIDADFRRASVAPRFGLGDPPGLSDLLVSEED
PSSYLIDIGVDNLTLLPAGTLPPNPAALLASGQMHLVLEELAAKADMIVVDSPPVLTGAD
TLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGDSARATYSYTSR
ERAVTGTDA
SITEWalker A318/320GKT
SITEWalker A'338/345VLIDADFR
SITEWalker B418/424IVVDSPP
SITEY Cluster485/487YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALLVLLAAVAVSCAYSLAATPLYIATADVLIEPSGADISASSGTKIDADEVATQVQVVTSLPVSRLVQERFSLASPPDL
MALLVLLAAVAVSCAYSLAATPLYIATADVLIEPSGADISASSGTKIDADEVATQVQVVTSLPVSRLVQERFSLASPPDL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELVSVQAVGTSRILRVTAQDSSPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRLSEVNALLEKNPG
SELVSVQAVGTSRILRVTAQDSSPDRAARTANIVATS                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQALQGERRTLIASSAQVAAQIDALTDSLTTAAAGGELLHSAEPADNPVSPQIVLNLILGALVGLVLGVGAALLRDRLDD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVHDEEAVRQALDAVVLARVPQWSERSHRDRLVTLVDPHSPASEEYQRLGVNVRFMVATGAQESAPIVLLTSGQESEGKT
                                                                      TSGQESEGKT
                                                                             GKT
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTSCNLAVSAARLGLNVVLIDADFRRASVAPRFGLGDPPGLSDLLVSEEDPSSYLIDIGVDNLTLLPAGTLPPNPAALLA
VTSCNLAVSAARLGLNVVLIDADFRRASVAPRFGLGDPPGLSDLLVSEEDPSSYLIDIGVDNLTLLPAGTLPPNPAALLA
                 VLIDADFR                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGQMHLVLEELAAKADMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGDS
SGQMHLVLEELAAKADMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGDS
                 IVVDSPP                                                        
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARATYSYTSRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGTPPPSGDTHHGSAPTGHRDTPPVAPAGHGDSRKTAVAEP
ARATYSYTSRERAVTGTDA                                                             
    YSY                                                                         
     
....:
GDDVA


© 1998-2019