BYKdb

Annotate results for A0A0Q9U9A8

A0A0Q9U9A8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9U9A8
DOMAINtad1/134MTFREFLGVLGARWRIIAVSLLAVVAAAAVQTMLTPAVYTSTAKIFLSATQPAAASTNNQ
VTTYAVSADDLARYLDVLNAPSVIEPLRERLGLAPDAPLSVSGEVAQTSNIMTITATGGD
PVLLARIANEAGPV
DOMAINcd267/454TSSVPGEGKTTTTVNLAIAMADAGSRVLLIDGDLRNPSVASTMGLDGSFGLTTLLLGQAD
TDDVVQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVID
AVLINKLTHGLIMVVGAERTKKRDLASAVQSLETVDAPVAGFALNMVSSGSSTTHRYGYY
GYNRDADA
SITEWalker A274/276GKT
SITEWalker A'294/301LLIDGDLR
SITEWalker B374/380ILVDSPP
SITEY Cluster443/448YGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTFREFLGVLGARWRIIAVSLLAVVAAAAVQTMLTPAVYTSTAKIFLSATQPAAASTNNQVTTYAVSADDLARYLDVLNA
MTFREFLGVLGARWRIIAVSLLAVVAAAAVQTMLTPAVYTSTAKIFLSATQPAAASTNNQVTTYAVSADDLARYLDVLNA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSVIEPLRERLGLAPDAPLSVSGEVAQTSNIMTITATGGDPVLLARIANEAGPVLADVATKKFSPLLAANGQSVEATPIA
PSVIEPLRERLGLAPDAPLSVSGEVAQTSNIMTITATGGDPVLLARIANEAGPV                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PATVPTEPVSPNAKRNLLLSGLLGLALGIGLALLRHTLDTKVRTEDDIKALSDRPILGDIPMVKSVKNGLLSLESDPHGR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAESIRRLRTNILFVDVTTAGHSFVITSSVPGEGKTTTTVNLAIAMADAGSRVLLIDGDLRNPSVASTMGLDGSFGLTTL
                          TSSVPGEGKTTTTVNLAIAMADAGSRVLLIDGDLRNPSVASTMGLDGSFGLTTL
                                 GKT                 LLIDGDLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGQADTDDVVQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMV
LLGQADTDDVVQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMV
                                                     ILVDSPP                    
       410       420       430       440       450       460         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
VGAERTKKRDLASAVQSLETVDAPVAGFALNMVSSGSSTTHRYGYYGYNRDADAKPSRREKRSRSKHHA
VGAERTKKRDLASAVQSLETVDAPVAGFALNMVSSGSSTTHRYGYYGYNRDADA               
                                          YGYYGY                     
© 1998-2019