BYKdb

Annotate results for A0A0Q9ZZQ4

A0A0Q9ZZQ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q9ZZQ4
DOMAINtad14/271DEIDLRELLGVLVDRKWWIIATTLVFLVLGTAYALLASPIYQAQAMVQVESKMPSIPGLA
DLTSLTGSGSTAATTEVALLTSRTVVGTAVDNLHLDTEVEPKRFPLIGGFLARRFEAKSP
DELAPPSFGMSRYGWGGETLEIHKLEVPPALIDESMTLEVGESPDSFVLYDNDGEELLRG
KVGVPVKGRTTTLEVASLRANPGTRFEVVRSRRLDAIAKLQEEIKAEEQGKESGILQITY
EDKDPLRAEALVQNVAEA
DOMAINcd555/742SGPRPGVGKTFISANLAAVIAQGGQKVLVIDADMRKGTLHKVLGVTHTQGLSDVLVGKLD
VRAAIHAVDGLENMHYVVRGDIPPNPAELLMHPRFQQMLEELAREYDLVIVDTPPILAVT
DAALVATHAGSSLLVTRFGLNQPKEILLTMQRFEQNGVQVKGAIFNAVEKRATGYYSYGY
YEYSAKEA
SITEWalker A562/564GKT
SITEWalker A'582/589LVIDADMR
SITEWalker B663/669VIVDTPP
SITEY Cluster729/737YYSYGYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTKQTGTRTNRDEDEIDLRELLGVLVDRKWWIIATTLVFLVLGTAYALLASPIYQAQAMVQVESKMPSIPGLADLTSLTG
             DEIDLRELLGVLVDRKWWIIATTLVFLVLGTAYALLASPIYQAQAMVQVESKMPSIPGLADLTSLTG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGSTAATTEVALLTSRTVVGTAVDNLHLDTEVEPKRFPLIGGFLARRFEAKSPDELAPPSFGMSRYGWGGETLEIHKLEV
SGSTAATTEVALLTSRTVVGTAVDNLHLDTEVEPKRFPLIGGFLARRFEAKSPDELAPPSFGMSRYGWGGETLEIHKLEV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPALIDESMTLEVGESPDSFVLYDNDGEELLRGKVGVPVKGRTTTLEVASLRANPGTRFEVVRSRRLDAIAKLQEEIKAE
PPALIDESMTLEVGESPDSFVLYDNDGEELLRGKVGVPVKGRTTTLEVASLRANPGTRFEVVRSRRLDAIAKLQEEIKAE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQGKESGILQITYEDKDPLRAEALVQNVAEAYVRQNVERSSADAAAQLQFVRDQLPSVRKQVEDAQAAMAAYQSRANSVD
EQGKESGILQITYEDKDPLRAEALVQNVAEA                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITMQTKGLLEQEVAVETSIQQLRLKQAEMDRSYTREHPAYRALLKQIGDLESRKDGFRREVNALPDTQQELLRLTRDLQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNELYTALLNQAQQLDVARAGTVGNVRIVDPAVVDISEPVKPRKALVVLVSLLLGAFLSIGAVFLQRMLNPGIEDPAQIE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGLPVYAAIPLSDSRALPKLKRTRSGQQRIVSDGRSHLLAAAAPADLAVEALRSLRTSLHFAMLEAKNNILAISGPRPG
                                                                          SGPRPG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGKTFISANLAAVIAQGGQKVLVIDADMRKGTLHKVLGVTHTQGLSDVLVGKLDVRAAIHAVDGLENMHYVVRGDIPPNP
VGKTFISANLAAVIAQGGQKVLVIDADMRKGTLHKVLGVTHTQGLSDVLVGKLDVRAAIHAVDGLENMHYVVRGDIPPNP
 GKT                 LVIDADMR                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELLMHPRFQQMLEELAREYDLVIVDTPPILAVTDAALVATHAGSSLLVTRFGLNQPKEILLTMQRFEQNGVQVKGAIFN
AELLMHPRFQQMLEELAREYDLVIVDTPPILAVTDAALVATHAGSSLLVTRFGLNQPKEILLTMQRFEQNGVQVKGAIFN
                      VIVDTPP                                                   
       730       740  
....:....|....:....|..
AVEKRATGYYSYGYYEYSAKEA
AVEKRATGYYSYGYYEYSAKEA
        YYSYGYYEY     

© 1998-2019