BYKdb

Annotate results for A0A0R0BVC7

A0A0R0BVC7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R0BVC7
DOMAINcd20/207SGPRPGIGKTFIAANLAAVIAQAGQKVIVVDADMRRGTLHKVLGAAHSAGLSDVLAGKVE
LNAAISTAPGLDGMHYIGRGEVPPSPSELLMHPRFAQILEELERNYDLVIIDTPPVLAVT
DAVIVAKHAGSTLMVTRFGVNHPKEIRLAMKRFEQNGVQVKGAIFNAVEKRKTGYHSYAY
YEYASDTP
SITEWalker A27/29GKT
SITEWalker A'47/54IVVDADMR
SITEWalker B128/134VIIDTPP
SITEY Cluster194/202YHSYAYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRTSLHFAMMEAKNNILVVSGPRPGIGKTFIAANLAAVIAQAGQKVIVVDADMRRGTLHKVLGAAHSAGLSDVLAGKVEL
                   SGPRPGIGKTFIAANLAAVIAQAGQKVIVVDADMRRGTLHKVLGAAHSAGLSDVLAGKVEL
                          GKT                 IVVDADMR                          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAAISTAPGLDGMHYIGRGEVPPSPSELLMHPRFAQILEELERNYDLVIIDTPPVLAVTDAVIVAKHAGSTLMVTRFGVN
NAAISTAPGLDGMHYIGRGEVPPSPSELLMHPRFAQILEELERNYDLVIIDTPPVLAVTDAVIVAKHAGSTLMVTRFGVN
                                               VIIDTPP                          
       170       180       190       200       
....:....|....:....|....:....|....:....|....:..
HPKEIRLAMKRFEQNGVQVKGAIFNAVEKRKTGYHSYAYYEYASDTP
HPKEIRLAMKRFEQNGVQVKGAIFNAVEKRKTGYHSYAYYEYASDTP
                                 YHSYAYYEY     
© 1998-2019