BYKdb

Annotate results for A0A0R0BWA6

A0A0R0BWA6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0R0BWA6
DOMAINtad23/192DEIDLREYWNILMDRRWLVLGVTAAVVLLTLAGTLLTTPVYRAGSSIQIERDTLNVINVE
GVTPMESTADRDFYQTQYELLKSRSLAQRVVQDAQLTAHPVYAEQMAALAERAQENGKPL
TELERERALVGGVLAGMTVAPVRNSRLVNLQFDATDPALAARVSNTWAEA
DOMAINcd527/714TSAGAGEGKSTSAAELARNIAQLGKRVLLIDADLRKPSQHHLAGVGNSIGLSNLLAGACS
IEESIMQVPALGHDLMLSGPLPPSPPELLAGDRLPALLRELGQQYEVIIIDGPPVLGLAD
APLLAHHAEATVLVAAAEATRDDSLVLANGRLQAAHARVLGSLLTRHNPRHGSSGYGYAY
YEYGTGQG
SITEWalker A534/536GKS
SITEWalker A'554/561LLIDADLR
SITEWalker B634/640IIIDGPP
SITEY Cluster702/709YGYAYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESLPMSSTTETSNTTREAQDSDEIDLREYWNILMDRRWLVLGVTAAVVLLTLAGTLLTTPVYRAGSSIQIERDTLNVIN
                      DEIDLREYWNILMDRRWLVLGVTAAVVLLTLAGTLLTTPVYRAGSSIQIERDTLNVIN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEGVTPMESTADRDFYQTQYELLKSRSLAQRVVQDAQLTAHPVYAEQMAALAERAQENGKPLTELERERALVGGVLAGMT
VEGVTPMESTADRDFYQTQYELLKSRSLAQRVVQDAQLTAHPVYAEQMAALAERAQENGKPLTELERERALVGGVLAGMT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAPVRNSRLVNLQFDATDPALAARVSNTWAEAFIASNLERRFEASSYASKYLEERLAQLKARLEDSEKALVAFASEQQLV
VAPVRNSRLVNLQFDATDPALAARVSNTWAEA                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVGEGSPSLAAQNLGELNSALAAAQQERIKAESIWQQARTGDGLGLSQVVASPLIQRLREQRAQLRGEYQNRLATYKPDY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDMQRLASQISEIDLQIQTEVRHIRAALEADHQASLAREQLLLDRIEQLKGDVLDLQDRSIQYNILRREAETNRQLYDGL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRYKEIGVAGGVGANNISVVDRAEVPRNPHSPRLPLNLAIGLLLGGFAGVLLAFVLHFLDRAIHSPKQLEALLERPVLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVPLLAKQTPQQAAADPRSAFSEAYRSVRTALQFSTSHGLPHTLFITSAGAGEGKSTSAAELARNIAQLGKRVLLIDADL
                                              TSAGAGEGKSTSAAELARNIAQLGKRVLLIDADL
                                                     GKS                 LLIDADL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPSQHHLAGVGNSIGLSNLLAGACSIEESIMQVPALGHDLMLSGPLPPSPPELLAGDRLPALLRELGQQYEVIIIDGPP
RKPSQHHLAGVGNSIGLSNLLAGACSIEESIMQVPALGHDLMLSGPLPPSPPELLAGDRLPALLRELGQQYEVIIIDGPP
R                                                                        IIIDGPP
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
VLGLADAPLLAHHAEATVLVAAAEATRDDSLVLANGRLQAAHARVLGSLLTRHNPRHGSSGYGYAYYEYGTGQG
VLGLADAPLLAHHAEATVLVAAAEATRDDSLVLANGRLQAAHARVLGSLLTRHNPRHGSSGYGYAYYEYGTGQG
                                                             YGYAYYEY     

© 1998-2019