BYKdb

Annotate results for A0A0R1EM05

A0A0R1EM05 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1EM05
DOMAINcd63/249TSSTMFEGKSTVSANVAVTWAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTVLTGKSK
PSEVVEETFVDNLSIIPSGPIPPNPSELLNSKRMSDLLDWTRENFDIVVLDAPPVLAVSD
VQVLVPKTDGVVIVTKIGQTQKSDLRRTVEVLKLAKAKILGSVERVKSRHGDKGYGYGYG
YGYQSNA
SITE-119/-121GKS
SITEWalker A'90/97LLIDADLR
SITEWalker B170/176VVLDAPP
SITEY Cluster237/245YGYGYGYGY
SITEWalker A70/72GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMNWLFKFGFKRKQEDQESQKNGVMLVTYAEPKHVVSEQYRTVRTNIEFAGAALDKCQVVMFTSSTMFEGKSTVSANVAV
                                                              TSSTMFEGKSTVSANVAV
                                                                     GKS        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TWAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTVLTGKSKPSEVVEETFVDNLSIIPSGPIPPNPSELLNSKRMSDLL
TWAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTVLTGKSKPSEVVEETFVDNLSIIPSGPIPPNPSELLNSKRMSDLL
         LLIDADLR                                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DWTRENFDIVVLDAPPVLAVSDVQVLVPKTDGVVIVTKIGQTQKSDLRRTVEVLKLAKAKILGSVERVKSRHGDKGYGYG
DWTRENFDIVVLDAPPVLAVSDVQVLVPKTDGVVIVTKIGQTQKSDLRRTVEVLKLAKAKILGSVERVKSRHGDKGYGYG
         VVLDAPP                                                            YGYG
         
....:....
YGYGYQSNA
YGYGYQSNA
YGYGY    
© 1998-2019