BYKdb

Annotate results for A0A0R1GF52

A0A0R1GF52 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1GF52
DOMAINcd43/232TSAGPSEGKSTVSANLAATWTAQNTNVLIVDADLRRPTVHRTFGLSNNQGLTTLLTNPEV
KLDQVIMQTAVNHLYALPSGPIPPNPAELLGSERMDKLMQILKNSFDLVLFDVPPVISVT
DAQIMANKVDGVILVTPQGLAEKGAVMKSKELLEAVHANILGVIMNRVHAEGTGGYYGGY
YGGYYGTDDK
SITEWalker A50/52GKS
SITEWalker A'70/77LIVDADLR
SITEWalker B151/157VLFDVPP
SITEY Cluster218/227YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQHGVSLITVNDPTSVVSEQFRTIRTNIQFSAVASKLKTLLVTSAGPSEGKSTVSANLAATWTAQNTNVLIVDADLRRPT
                                          TSAGPSEGKSTVSANLAATWTAQNTNVLIVDADLRRPT
                                                 GKS                 LIVDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHRTFGLSNNQGLTTLLTNPEVKLDQVIMQTAVNHLYALPSGPIPPNPAELLGSERMDKLMQILKNSFDLVLFDVPPVIS
VHRTFGLSNNQGLTTLLTNPEVKLDQVIMQTAVNHLYALPSGPIPPNPAELLGSERMDKLMQILKNSFDLVLFDVPPVIS
                                                                      VLFDVPP   
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VTDAQIMANKVDGVILVTPQGLAEKGAVMKSKELLEAVHANILGVIMNRVHAEGTGGYYGGYYGGYYGTDDKK
VTDAQIMANKVDGVILVTPQGLAEKGAVMKSKELLEAVHANILGVIMNRVHAEGTGGYYGGYYGGYYGTDDK 
                                                         YYGGYYGGYY      
© 1998-2019